DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and Med7

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001098000.1 Gene:Med7 / 66213 MGIID:1913463 Length:233 Species:Mus musculus


Alignment Length:227 Identity:116/227 - (51%)
Similarity:156/227 - (68%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEM-IRSLESQNIKRLI 70
            |||:||.||.:||..||||||:...||:||||  ..:.|.|||.|:..|:: ||.||||.|:||.
Mouse     6 QVSALPPPPMQYIKEYTDENIQEGLAPKPPPP--IKDSYMMFGNQFQCDDLIIRPLESQGIERLH 68

  Fly    71 PIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARE 135
            |:.||.:|||:|||.|:|:|||||:|.||.:|.|.:|.||::|:.||||::|||:||:|||||||
Mouse    69 PMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARE 133

  Fly   136 TLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDDDDDSGGAKIKTEVDPLE----A 196
            |||||||:|||||:|||.|||||||||.|::....::||   ||.....|.::.:.:|::    :
Mouse   134 TLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLP---DDLPHSEAGMRVKAEPMDTDDNS 195

  Fly   197 NAAAKN-----------DPSYQHDRMLCKLVD 217
            |...:|           |...:.|..||.|:|
Mouse   196 NCPGQNEQQRESSGHRRDQIIEKDAALCVLID 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 101/158 (64%)
Med7NP_001098000.1 Med7 7..164 CDD:368693 101/158 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..214 3/26 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I3017
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3153
Inparanoid 1 1.050 216 1.000 Inparanoid score I3591
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57344
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 1 1.000 - - oto92908
orthoMCL 1 0.900 - - OOG6_103150
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3177
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.