DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and med7

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_956035.1 Gene:med7 / 326098 ZFINID:ZDB-GENE-030131-4823 Length:241 Species:Danio rerio


Alignment Length:237 Identity:121/237 - (51%)
Similarity:161/237 - (67%) Gaps:30/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEM-IRSLESQNIKRLI 70
            |||:||.||.:||..|||||:|:..||:||||  ..:.|.|||.|:..|:: ||.||||.|:||.
Zfish     6 QVSALPPPPMQYIKEYTDENVRKGLAPKPPPP--IRDSYMMFGNQFQCDDLIIRPLESQGIERLH 68

  Fly    71 PIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARE 135
            |:.||.::||||||.|:|||||||:|.||.:|.|.:|.||::|:.||||:||||:||:|||||||
Zfish    69 PMQFDHKRELKKLNMSILVNFLDLLDILIKSPGSIKREEKLEDLKLLFVHMHHLINEYRPHQARE 133

  Fly   136 TLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDD------------DDDSGGAKIK 188
            |||||||:|||||:|||.|||||||||.|::....|:||  ||            ...:|.:::|
Zfish   134 TLRVMMEVQKRQRLETAERFQKHLERVVEMIQGCLSSLP--DDLPLPNSSSMGEAGSAAGSSRLK 196

  Fly   189 TE---VDPL----------EANAAAKNDPSYQHDRMLCKLVD 217
            ||   ||.:          :.|...|.|....:|.::|:::|
Zfish   197 TEPMDVDDVAGASCMVLQTDKNVPVKKDGVCDNDVVMCRIID 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 103/158 (65%)
med7NP_956035.1 Med7 7..164 CDD:283604 103/158 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197 1/21 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2875
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3153
Inparanoid 1 1.050 221 1.000 Inparanoid score I3521
OMA 1 1.010 - - QHG57344
OrthoDB 1 1.010 - - D1356482at2759
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 1 1.000 - - oto40892
orthoMCL 1 0.900 - - OOG6_103150
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R706
SonicParanoid 1 1.000 - - X3177
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.