DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and med7

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_596734.1 Gene:med7 / 2539773 PomBaseID:SPBC14F5.08 Length:376 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:39/147 - (26%)
Similarity:80/147 - (54%) Gaps:29/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVM 140
            |..||:.|:.||::|||:|:..:...|:  :...|:::|.:|.:|:|||:|::||||:||:|.::
pombe   224 RAYELRFLSRSLMLNFLELLGIMAKAPE--QFPSKVENIRVLLLNLHHLINDYRPHQSRESLIML 286

  Fly   141 MEMQ--------------KRQRVETAARFQK---HLERVREIVNTAFSAL--PVLDDDDD----- 181
            :|.|              .||..||..:::.   ::|:..:::....|::  |:...:|:     
pombe   287 LEKQLKHEESQVELLRTHNRQMTETLEKYKSLDFNMEKEGDVIQQLKSSIKKPLSGAEDEQKSRS 351

  Fly   182 ---SGGAKIKTEVDPLE 195
               ....|:|..::.:|
pombe   352 MFSKNDEKLKKSLELME 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 33/106 (31%)
med7NP_596734.1 Med7 11..312 CDD:310518 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103150
Panther 1 1.100 - - LDO PTHR21428
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R706
SonicParanoid 1 1.000 - - X3177
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.