DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and let-49

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_493585.1 Gene:let-49 / 173353 WormBaseID:WBGene00002324 Length:253 Species:Caenorhabditis elegans


Alignment Length:167 Identity:64/167 - (38%)
Similarity:99/167 - (59%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYN-NDEMIRSLESQNIKRLIP 71
            ||..|.||| |.:.||.:.|..:....||||....| :.::|.:|. .|::|..|::..:..|..
 Worm    10 VSPFPNPPE-YASAYTSDRINNDSGSAPPPPHPLTE-FKVYGEEYRLEDDVIAPLKNAGVAELYK 72

  Fly    72 IHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARET 136
            ...:.:.|:||||.|.:|.|.||::.||..||.|.|.||:.|:..:|:|||||:|||||.|||::
 Worm    73 NKNNWKTEMKKLNRSAIVAFFDLVEILIRAPDHPMREEKMVDLHTIFINMHHLINEFRPVQARDS 137

  Fly   137 LRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSAL 173
            :|::.|.|..:..:....|:|:|...||:|:..|..:
 Worm   138 VRILQERQIEELSDICKDFKKYLRDGREVVDDQFQMI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 62/158 (39%)
let-49NP_493585.1 Med7 10..167 CDD:283604 62/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166442
Domainoid 1 1.000 118 1.000 Domainoid score I3670
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3153
Inparanoid 1 1.050 123 1.000 Inparanoid score I3304
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57344
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 1 1.000 - - oto19091
orthoMCL 1 0.900 - - OOG6_103150
Panther 1 1.100 - - LDO PTHR21428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R706
SonicParanoid 1 1.000 - - X3177
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.