DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and Med7

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001273112.1 Gene:Med7 / 100911235 RGDID:6494481 Length:233 Species:Rattus norvegicus


Alignment Length:228 Identity:119/228 - (52%)
Similarity:157/228 - (68%) Gaps:23/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEM-IRSLESQNIKRLI 70
            |||:||.||.:||..||||||:...||:||||  ..:.|.|||.|:..|:: ||.||||.|:||.
  Rat     6 QVSALPPPPMQYIKEYTDENIQEGLAPKPPPP--IKDSYMMFGNQFQCDDLIIRPLESQGIERLH 68

  Fly    71 PIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARE 135
            |:.||.:|||:|||.|:|:|||||:|.||.:|.|.:|.||::|:.||||::|||:||:|||||||
  Rat    69 PMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARE 133

  Fly   136 TLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDD-DDDSGGAKIKTEVDPLE---- 195
            |||||||:|||||:|||.|||||||||.|::....::||  || .....|.::|||  |::    
  Rat   134 TLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLP--DDLPHSEAGMRVKTE--PMDTDDN 194

  Fly   196 ANAAAKN-----------DPSYQHDRMLCKLVD 217
            :|...:|           |...:.|..||.|:|
  Rat   195 SNCTGQNEQQRESSGHRRDQIIEKDAALCVLID 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 101/158 (64%)
Med7NP_001273112.1 Med7 7..164 CDD:399168 101/158 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I2924
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3153
Inparanoid 1 1.050 218 1.000 Inparanoid score I3498
OMA 1 1.010 - - QHG57344
OrthoDB 1 1.010 - - D1356482at2759
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 1 1.000 - - oto96462
orthoMCL 1 0.900 - - OOG6_103150
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3177
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.