DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and SLC22A16

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens


Alignment Length:472 Identity:98/472 - (20%)
Similarity:182/472 - (38%) Gaps:160/472 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GMIISAVPWGFIADTIGRRPVLISGGWLDG----FFVLCASLSQNTAQLMAFKFFDGLIICGPFA 137
            |:::.:|.:|:.:|.:|||.||    |...    .|.:.|:.:.:....||.:||..::..|...
Human   164 GVLLGSVTFGYFSDRLGRRVVL----WATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLV 224

  Fly   138 VVVSYLAEFHGKKHRPYIMLFVGLCVSIGSMILPLLSYLLLPVPILFTVSSMKFRTW---QVFLA 199
            |...|:.||.|.|.|.:..:.:....::|::::.|..||:              |||   |:.|:
Human   225 VGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLV--------------RTWWLYQMILS 275

  Fly   200 VSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESYPIKHLTDPTPDRSD 264
            ..:.|.:|..::   |||:|.:|:|:|.|::|...:..:.|.|:..|.:...:..|         
Human   276 TVTVPFILCCWV---LPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSL--------- 328

  Fly   265 DLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYLAISLQVYCLHFCQIMCVNSVRLWLPQI 329
            ||.|                          |:.:||.......:..|.:...:...::.:||  |
Human   329 DLQG--------------------------PVSNSPTEVQKHNLSYLFYNWSITKRTLTVWL--I 365

  Fly   330 FATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVECALHHDPDSYLNNITVAGIGLVGFLII 394
            :.|    .:||....|:        |:.::...|             |||      :.|:|.:.|
Human   366 WFT----GSLGFYSFSL--------NSVNLGGNE-------------YLN------LFLLGVVEI 399

  Fly   395 FPLMRFQVVSNHILKVFLFICIFL--VG-------SLYFVKTSLVTMMVSAVYLTMMGICATTII 450
                          ..:.|:||.:  ||       ||:....:...:||......::|: .|.::
Human   400 --------------PAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGV-VTAMV 449

  Fly   451 GMSVV-------------IFPTLMRTMVLLLIMTFGRLGSVSGNMLLPVFMQLSCLAPF------ 496
            |...:             ::||::|::.:           .||:|   |....|.||||      
Human   450 GKFAIGAAFGLIYLYTAELYPTIVRSLAV-----------GSGSM---VCRLASILAPFSVDLSS 500

  Fly   497 LWLCSLMSIAFLFSLFL 513
            :|:       |:..||:
Human   501 IWI-------FIPQLFV 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 35/145 (24%)
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 98/472 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.