DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and oct2

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001107932.1 Gene:oct2 / 797890 ZFINID:ZDB-GENE-080204-92 Length:554 Species:Danio rerio


Alignment Length:254 Identity:66/254 - (25%)
Similarity:111/254 - (43%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CGFGLFNVFILCSAVPCLTAMVFSASALSYVMP-SAECDLDLSIVDKGMLHAVTYA-GMIISAVP 84
            |...:||.....||  |.....|:.:..:.|.. |..|: |..:.|   |:.|:.| |..|.|:.
Zfish    98 CNISIFNNSTHLSA--CNEGWTFNENRTTIVTEFSLVCE-DSWLAD---LNQVSLAGGFFIGALV 156

  Fly    85 WGFIADTIGRRPVLISGGWLDGFFVLCASLSQNTAQLMAFKFFDGLIICGPFAVVVSYLAEFHGK 149
            .|::||..||:...|:..:..|....|...|.....|:.|:...|....|.:......:.||.|.
Zfish   157 TGYLADRFGRKSCFIASIFGLGVSGTCIIFSPYYPLLLFFRCLQGFFAKGAWTATYVLIIEFFGS 221

  Fly   150 KHRPYIMLFVGLCVSIGSMILPLLSYLLLPVPILFTVSSMKFRTWQVFLAVSSAPSLLSGFLHIF 214
            .:|.::.:......|:|.::||.|:|.   :|           :|:......:.|:.:....|..
Zfish   222 NNRKFVSVMSRTFYSLGLVLLPALAYY---IP-----------SWRNLQLAMTLPTFIFLIYHWV 272

  Fly   215 LPESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESYPIKHLTDPTPDRSDDLDGTGRPS 273
            :||||::|:||...|:||..::.|.|.|||...|.:   |..|...::.:::   .|||
Zfish   273 IPESPRWLLSQRKTKEALSIVKSIAKCNKRSLPEDF---HEMDLLIEKQEEI---MRPS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 42/187 (22%)
oct2NP_001107932.1 2A0119 12..516 CDD:273328 66/254 (26%)
MFS 123..506 CDD:119392 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.