DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and slc22a7a

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001077330.1 Gene:slc22a7a / 794188 ZFINID:ZDB-GENE-050506-52 Length:560 Species:Danio rerio


Alignment Length:215 Identity:50/215 - (23%)
Similarity:96/215 - (44%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AVPCLTAMVFSASALSYVMPSAECDLDLSIVDKGMLHAVT---YAGMIISAVPWGFIADTIGRRP 96
            :|||....|:..|..:   .:...:.||...:|.:..|:.   :.|:.:.||.:|.::|..||:|
Zfish   113 SVPCQNGWVYDRSQFT---STTATEWDLVCDNKKLNQALATFFFIGVTMGAVVFGQLSDKFGRKP 174

  Fly    97 VLISGGWLDGFFVLCASLSQNTAQLMAFKFFDGLIICGPFAVVVSYLAEFHGKKHRPYIMLFVGL 161
            ::.........|.:..:.|.:.......:...|..:.|.....|:...|:...|||.:....:.|
Zfish   175 MIQVSFVSSAVFGIIEAFSSSYVMFAIARTLCGFALTGMSITTVALCVEWTDVKHRTFTGTIISL 239

  Fly   162 CVSIGSMILPLLSYLLLPVPILFTVSSMKFRTWQVFLAVSSAPSLLSGFLHIFLPESPKFLMSQG 226
            ..|:|:|:|.||:||:              |.|:..:.|.::|.|:......::|||.::|::.|
Zfish   240 GWSVGNMLLALLAYLI--------------RDWRHLILVVTSPCLVGIIAWWWIPESARWLLANG 290

  Fly   227 NYKKALDSLQRIYKLNKRKS 246
            ..::|...|....|:|.:.|
Zfish   291 RVEEAQKYLINCAKMNGKYS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 40/183 (22%)
slc22a7aNP_001077330.1 2A0119 11..523 CDD:273328 50/215 (23%)
MFS 148..514 CDD:119392 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.