DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and SLC22A5

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001295051.1 Gene:SLC22A5 / 6584 HGNCID:10969 Length:581 Species:Homo sapiens


Alignment Length:469 Identity:104/469 - (22%)
Similarity:187/469 - (39%) Gaps:139/469 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YAGMIISAVPWGFIADTIGRRPVL-ISGGWLDGFFVLCASLSQNTAQLMAFKFFDGLIICGPFAV 138
            :.|:::.:...|.::|..||:.|| ::.|...||..| ...|:|      |:.|..|.:......
Human   174 FVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFL-QIFSKN------FEMFVVLFVLVGMGQ 231

  Fly   139 VVSYLA------EFHGKKHRPYIMLFVGLCV--SIGSMILPLLSYLLLPVPILFTVSSMKFRTWQ 195
            :.:|:|      |..||..| .|...:|:|:  :.|.|:|||.:|.:              |.|:
Human   232 ISNYVAAFVLGTEILGKSVR-IIFSTLGVCIFYAFGYMVLPLFAYFI--------------RDWR 281

  Fly   196 VFLAVSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESYPIKHLTDPTP 260
            :.|...:.|.:|...|..|:||||::|:|||.:::|...:::..|.|                  
Human   282 MLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKAN------------------ 328

  Fly   261 DRSDDLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYLAISLQVYCLHFCQIMCVNSVRLW 325
                   |...|||:   |..::.:.:...||     .|..:...|:.:.:....||   |:.||
Human   329 -------GIVVPSTI---FDPSELQDLSSKKQ-----QSHNILDLLRTWNIRMVTIM---SIMLW 375

  Fly   326 LPQIFATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVECALHHDPDSYLNNITVAGIGLVG 390
            :           |:......:           |:|...      ||  .|.::|....|.:.:..
Human   376 M-----------TISVGYFGL-----------SLDTPN------LH--GDIFVNCFLSAMVEVPA 410

  Fly   391 FLIIFPLMRFQVVSNHILKVFLFICIFLVGS-----------LYFVKTSL-------VTMMVSAV 437
            :::.:.|:::..     .:..:...:||.||           ||::.|.|       ||...|.|
Human   411 YVLAWLLLQYLP-----RRYSMATALFLGGSVLLFMQLVPPDLYYLATVLVMVGKFGVTAAFSMV 470

  Fly   438 YLTMMGICATTIIGMSVVIFPTLMRTMVLLLIMTFGRLGSVSGNMLLPVFMQLSC---LAPFLWL 499
            |:            .:..::||::|.|.:.:..|..||||:    |.|.|:.|..   ..|::.:
Human   471 YV------------YTAELYPTVVRNMGVGVSSTASRLGSI----LSPYFVYLGAYDRFLPYILM 519

  Fly   500 CSLMSIAFLFSLFL 513
            .||..:..:.:|||
Human   520 GSLTILTAILTLFL 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 38/149 (26%)
SLC22A5NP_001295051.1 2A0119 12..544 CDD:273328 104/469 (22%)
MFS 162..534 CDD:119392 104/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.