DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and CG4465

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster


Alignment Length:493 Identity:88/493 - (17%)
Similarity:164/493 - (33%) Gaps:162/493 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GMIISAVPWGFIADTIGRRPVLISGGW-------LDGF---FVLCASLSQNTAQLMAFKFFDGLI 131
            |::|..|....:...:..|.:..:|.|       |.|.   |.|...|....|....|....|..
  Fly   179 GLLIGGVAATKLMRVLSPRQIYRTGIWCLLMCSLLMGLVKDFSLHCGLRCLAAVSCCFMITSGQY 243

  Fly   132 ICGPFAVVVSYLAEFHGKKHRPYIMLFVGLCVSIGSMILPLLSYLLLPVPILFTVSSMKFRTWQ- 195
            |.|          :....|:|...::......::|.::||.|              :....:|| 
  Fly   244 IFG----------DITAGKYRVGTLILYDCFWALGLILLPGL--------------ASNAPSWQH 284

  Fly   196 VFLAVSSAPSLLSGFLHIFL----PESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESYPIKHLT 256
            ::|.|:     ||..:.:||    |:||::.:.  :.|:|..:::|...:....:|.:..:..::
  Fly   285 IYLGVT-----LSLLVIVFLLPWTPDSPRWQLQ--HTKEAQLAIERTVGILLEAARTNGRMHKVS 342

  Fly   257 DPTPDRSDDLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYLAISLQVYCLHFCQIMCVNS 321
            ...|.:.::         |:||             .|:||.:         |:.:|         
  Fly   343 KELPQQLEE---------LRER-------------MLEPMPA---------VHWMH--------- 367

  Fly   322 VRLWLPQIFATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVECALHHDPDSYLNNITVAGI 386
              ||:.|..:|.:             .|..|.|.|..|                       |...
  Fly   368 --LWMGQRRSTFH-------------LVAVHMALATFM-----------------------VVNT 394

  Fly   387 GLVGFLIIFPLMRFQVVSN-------HILKVFLFICI----------------FLVGSLYFVKTS 428
            ||:  |.:....|..:|||       .:|..||.:.:                .:||.:..:...
  Fly   395 GLL--LHVRSFGREHLVSNTLAMGLAEMLGCFLALHLTFNLSERKWQWAGGFAIVVGCIGSICWF 457

  Fly   429 LVTMMVSAVYLTMMGI-----------CA-TTIIGMSVVIFPTLMRTMVLLLIMTFGRLGSVSGN 481
            |....:..||...:|:           || :.|:.....:.|...|:.:....:|:.|:..:|.:
  Fly   458 LAEEDMPEVYGLTLGLLMASLPQAAVACAQSMILACLGELVPMEQRSCLSFSAVTWARVWQLSAS 522

  Fly   482 MLLPVFMQLSCLAPFLWLCSLMSIAFLFSLFLKVDDEQ 519
             .|.:..|:|........|.|:.:..|.:..|...|::
  Fly   523 -FLTLLRQVSPALSLSAFCLLVILGGLGTCCLVTRDKE 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 30/153 (20%)
CG4465NP_650847.1 2A0119 67..553 CDD:273328 86/485 (18%)
MFS 169..>303 CDD:119392 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.