DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and CG6126

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_650528.1 Gene:CG6126 / 41967 FlyBaseID:FBgn0038407 Length:555 Species:Drosophila melanogaster


Alignment Length:245 Identity:56/245 - (22%)
Similarity:94/245 - (38%) Gaps:83/245 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GMLHAVTYAGMIISAVPWGFIADTIGRRPV---LISGGWLDGFFVLCASLSQ----NTAQLMAFK 125
            |::...:|..::       |:.|.:|||.:   |:.||.|  ..::.|.::|    :||.:||.|
  Fly   372 GLVEFPSYITIV-------FVLDRLGRRSITSTLMLGGGL--CCIVAAYIAQGSTTSTAVVMAGK 427

  Fly   126 FFDGLIICGPFAVVVSYLAEFHGKKHRPYIMLFVGLCVSIGSMILPLLSYL-----LLPVPILFT 185
                |:|.|.|||:.:|.||......|...|....:|..:...:.||::.|     .:|. :||.
  Fly   428 ----LLIAGSFAVIYNYSAELFPTVVRNSAMGLGSMCARLSGALTPLITLLDSFDPKIPA-VLFG 487

  Fly   186 VSSMKFRTWQVFLAVSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESY 250
            |                 .:|:|||..:||||:                                
  Fly   488 V-----------------VALISGFWVMFLPET-------------------------------- 503

  Fly   251 PIKHLTDPTPDRSDDLDGTGRPST----LQERFSRAQSKFIDGFKQLKPM 296
                :..|.|:..:|.:..|:..|    ...|..|..|.:.|..:|:.|:
  Fly   504 ----MNQPMPESIEDGENFGKGDTWFSQCAGRKKRQNSVYPDDPEQMVPL 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 42/159 (26%)
CG6126NP_650528.1 2A0119 15..510 CDD:273328 46/204 (23%)
MFS 130..501 CDD:119392 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.