DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and Slc22a5

DIOPT Version :9

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_035526.1 Gene:Slc22a5 / 20520 MGIID:1329012 Length:557 Species:Mus musculus


Alignment Length:465 Identity:104/465 - (22%)
Similarity:191/465 - (41%) Gaps:133/465 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YAGMIISAVPWGFIADTIGRRPVL-ISGGWLDGF-FVLCASLSQNTAQLMAFKFFDGLIICGPFA 137
            :.|:::.:...|.::|..||:.|| ::.|...|| |:...|::        |:.|..|.:.....
Mouse   150 FVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVN--------FEMFTVLFVLVGMG 206

  Fly   138 VVVSYLA------EFHGKKHRPYIMLFVGLCV--SIGSMILPLLSYLLLPVPILFTVSSMKFRTW 194
            .:.:|:|      |...|..| .|...:|:|:  :.|.|:|||.:|.:              |.|
Mouse   207 QISNYVAAFVLGTEILSKSIR-IIFATLGVCIFYAFGFMVLPLFAYFI--------------RDW 256

  Fly   195 QVFLAVSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESYPIKHLTDPT 259
            ::.|...:.|.:|.|.|..|:||||::|:|||..|:|...:::..|:|                 
Mouse   257 RMLLLALTVPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKIN----------------- 304

  Fly   260 PDRSDDLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYLAISLQVYCLHFCQIMCVNSVRL 324
                    |...|||:   |..::   :......||.....|..|..:     ..:::.:.|:.|
Mouse   305 --------GIVAPSTI---FDPSE---LQDLNSTKPQLHHIYDLIRTR-----NIRVITIMSIIL 350

  Fly   325 WLPQIFATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVECALHHDPDSYLNNITVAGIGLV 389
            ||           |:......:           |:|...      ||  .|.|:|...:|.:.:.
Mouse   351 WL-----------TISVGYFGL-----------SLDTPN------LH--GDIYVNCFLLAAVEVP 385

  Fly   390 GFLIIFPLMRFQVVSNHILKVFLF----ICIF--LVGS-LYFVKTSLV-------TMMVSAVYLT 440
            .:::.:.|::: :...:.:...||    :.:|  ||.| |:::.|:||       |...|.||: 
Mouse   386 AYVLAWLLLQY-LPRRYSISAALFLGGSVLLFMQLVPSELFYLSTALVMVGKFGITSAYSMVYV- 448

  Fly   441 MMGICATTIIGMSVVIFPTLMRTMVLLLIMTFGRLGSVSGNMLLPVFMQLSC---LAPFLWLCSL 502
                       .:..::||::|.|.:.:..|..||||:    |.|.|:.|..   ..|::.:.||
Mouse   449 -----------YTAELYPTVVRNMGVGVSSTASRLGSI----LSPYFVYLGAYDRFLPYILMGSL 498

  Fly   503 MSIAFLFSLF 512
            ..:..:.:||
Mouse   499 TILTAILTLF 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 MFS 30..>216 CDD:119392 37/150 (25%)
Slc22a5NP_035526.1 2A0119 12..520 CDD:273328 104/465 (22%)
MFS 123..510 CDD:119392 104/465 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.