DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14691 and B0252.3

DIOPT Version :10

Sequence 1:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001021888.1 Gene:B0252.3 / 174130 WormBaseID:WBGene00015088 Length:484 Species:Caenorhabditis elegans


Alignment Length:167 Identity:35/167 - (20%)
Similarity:53/167 - (31%) Gaps:50/167 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 IVNPHGKGNANFNLKLT-------GFSSPTFVEKPQISSRD-------DGQVMVMEFRAKSILEP 451
            |..|.|.|.......|.       |||.......|:....|       |.:||..|.:....||.
 Worm   142 ISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEKEIKDGKFLEF 206

  Fly   452 TFVWQKLVGGGAEEIIANSDR---------IKAVKKLEAGNVYYSALEIKEPTKDKDAGQFIC-- 505
            ..|...|.|...|.:.|.:|.         ::..:.:.|.::  .|:.|           |:|  
 Worm   207 ASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGARSVRASSL--DAIFI-----------FVCPP 258

  Fly   506 TVKNESGKLTATFT------------VKFEVPEGAPS 530
            ::|....:|.|..|            .:.|:.||..|
 Worm   259 SMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14691NP_650012.2 synapt_SV2 2..>337 CDD:130366
MFS <375..513 CDD:475125 28/136 (21%)
B0252.3NP_001021888.1 MFS_SLC22 73..454 CDD:340875 35/167 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.