DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and HCAR3

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_006009.2 Gene:HCAR3 / 8843 HGNCID:16824 Length:387 Species:Homo sapiens


Alignment Length:383 Identity:93/383 - (24%)
Similarity:169/383 - (44%) Gaps:73/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLS 126
            ||:.:.|.|                  :.||.....:.|||:.|||...|......:..||.||:
Human    24 DFIAKVLPP------------------VLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLA 70

  Fly   127 IAD-LLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHP-- 188
            :|| ||:..|..|.:: ::..|||.||.|.|.:..|:..:....|:..|..::.|||..:|||  
Human    71 VADFLLIICLPFVMDY-YVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHH 134

  Fly   189 LKRRTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVC--FMMWPDGRYPTSMAD 251
            ...:.|.....||..|:|.::..|:.. ||...::.:   || :..||  |.:....|:..:|  
Human   135 ALNKISNWTAAIISCLLWGITVGLTVH-LLKKKLLIQ---NG-TANVCISFSICHTFRWHEAM-- 192

  Fly   252 YAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFA 316
                   .:|.:.:|:.::|.|   ..|::|..|      .|||:.....::.:...:.:..:|.
Human   193 -------FLLEFFLPLGIILFC---SARIIWSLR------QRQMDRHAKIKRAITFIMVVAIVFV 241

  Fly   317 ICWLP-----YHLFFIYAYHNNQVASTKYVQHMYLGFYWLAMS----NAMVNPLIYYWMNKRFRM 372
            ||:||     .|:|::  .|.:...:.:..:.:.|.|: :.:|    |:|::|::||:.:..|..
Human   242 ICFLPSVVVRIHIFWL--LHTSGTQNCEVYRSVDLAFF-ITLSFTYMNSMLDPVVYYFSSPSFPN 303

  Fly   373 YFQRIICCCCVGLTRHRFDSPKSRLTNKNSSNRHTRGGYTVAHSLPNSSPPTTQTLLA 430
            :|..:|..|.           :.::|.:..:||.|....|   ..||.:....:.|:|
Human   304 FFSTLINRCL-----------QRKITGEPDNNRSTSVELT---GDPNKTRGAPEALIA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 77/297 (26%)
7tm_1 100..363 CDD:278431 72/276 (26%)
HCAR3NP_006009.2 7tm_1 44..294 CDD:278431 72/276 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..343 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.