DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and GPR174

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_115942.1 Gene:GPR174 / 84636 HGNCID:30245 Length:333 Species:Homo sapiens


Alignment Length:303 Identity:75/303 - (24%)
Similarity:148/303 - (48%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDW 149
            |:|:.:.:::...:.||.:.||:..|:.........|::||:||||| ..|:......:.||.||
Human    21 IYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLL-QVLSLPLRIFYYLNHDW 84

  Fly   150 PFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRI-ILVLIWALSCVLS 213
            |||...|....::..|.:..|::.||.||..|:..:::|.:....::|..: |.:..|.:.|:  
Human    85 PFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIAGWLIICL-- 147

  Fly   214 APCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIIL----VLTYGIPMIVMLICY 274
             .|:|:..:.|....:| :||.||:     ..||...:.|.:::::    ::.:..|::::|.| 
Human   148 -ACVLFPLLRTSDDTSG-NRTKCFV-----DLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYC- 204

  Fly   275 SLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFF--IYAYHNNQVAS 337
                  .|.:....::.....:.:..|:|.::|.:....:|.||:.|||..|  .:...:|::.|
Human   205 ------TWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKS 263

  Fly   338 TKYVQHMYLGFY----WLAMSNAMVNPLIYYWMNKRFRMYFQR 376
            . ..:.:.|.|:    .||..|:.::|:|||:....||....|
Human   264 C-LARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFRRRLSR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 72/294 (24%)
7tm_1 100..363 CDD:278431 67/273 (25%)
GPR174NP_115942.1 7tm_1 36..292 CDD:278431 67/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.