DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and C3ar1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_114449.2 Gene:C3ar1 / 84007 RGDID:620537 Length:472 Species:Rattus norvegicus


Alignment Length:439 Identity:95/439 - (21%)
Similarity:153/439 - (34%) Gaps:162/439 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNC 137
            :||...|  |.....:|..|...:.:.|||:||| |.|.:..|||...:.|:|::||.|     |
  Rat    15 SRPLFKP--QDIASMVILSLTCLLGLPGNGLVLW-VAGVKMKRTVNTVWFLHLTLADFL-----C 71

  Fly   138 VFNFIF-----MLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPL--KRRTSR 195
            ..:..|     :|...||:|...|.:...|..:.:..|||.|.|||.||.:.:..|:  :...|.
  Rat    72 CLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDRCLMVHKPIWCQNHRSV 136

  Fly   196 RKVRIILVLIWALSCVLSAPCLLYSSIM------------------------------------- 223
            |....:...:|.::.|:..|..:|..::                                     
  Rat   137 RTAFAVCGCVWVVAFVMCIPVFVYRDLLVVDDYSVCGYNFDSSRAYDYWDYMYNSHLPEINPPDN 201

  Fly   224 -TKH--------------------------------------------YYNGKSRTVCFMMWPDG 243
             |.|                                            :|.||..||.....|.|
  Rat   202 STGHVDDRTAPSSVPARDLWTATTALQSQTFHTSPEDPFSQDSASQQPHYGGKPPTVLIATIPGG 266

  Fly   244 --------------------RYPTSMA------------DY---------------AYNLIILVL 261
                                ..|:..|            ||               |..:..||:
  Rat   267 FPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLYAHDFPDDYFDQLMYGNHAWTPQVAITISRLVV 331

  Fly   262 TYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFF 326
            .:.:|..:|:.||||:...:           |:....||:.|.:|:.:|:|::|.:||:|||:..
  Rat   332 GFLVPFFIMITCYSLIVFRM-----------RKTNLTKSRNKTLRVAVAVVTVFFVCWIPYHIVG 385

  Fly   327 IYAYHNNQVASTKYV----QHMYLGFYWLAMSNAMVNPLIYYWMNKRFR 371
            |.....:|.::.:.|    .||.:.   ||.:|:..||.:|..:.|.||
  Rat   386 ILLVITDQESALREVVLPWDHMSIA---LASANSCFNPFLYALLGKDFR 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 90/420 (21%)
7tm_1 100..363 CDD:278431 85/402 (21%)
C3ar1NP_114449.2 7tm_GPCRs 24..434 CDD:421689 91/428 (21%)
TM helix 1 25..51 CDD:410628 10/26 (38%)
TM helix 2 57..82 CDD:410628 7/29 (24%)
TM helix 3 95..125 CDD:410628 11/29 (38%)
TM helix 4 137..157 CDD:410628 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..251 0/18 (0%)
TM helix 5 321..346 CDD:410628 7/24 (29%)
TM helix 6 358..388 CDD:410628 13/29 (45%)
TM helix 7 402..427 CDD:410628 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.