DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and f2rl1.1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001073273.1 Gene:f2rl1.1 / 794649 ZFINID:ZDB-GENE-061215-140 Length:380 Species:Danio rerio


Alignment Length:416 Identity:93/416 - (22%)
Similarity:168/416 - (40%) Gaps:106/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VNTTLLGSLNRTEVVSLLSSIIDNRDNLESINEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFG 91
            |.:|.||.||..                         ||:..||             .::.|:|.
Zfish    44 VTSTALGVLNSK-------------------------LTQIFFP-------------VLYIIVFS 70

  Fly    92 LMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLM---SSLNCVFNFIFMLNSDWPFGS 153
                |.:..|.:.:|:.......:..::.|:.||::||||.   ..|...::|   ..:.|.||.
Zfish    71 ----VGLPTNAMAIWVFLFRTKKKHPSSIFMANLALADLLFVIWIPLKIAYHF---NGNHWIFGE 128

  Fly   154 IYC--TINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRI-ILVLIWALSCVLSAP 215
            ..|  .:..|..|:..||:.  :..||..||.||||||.::....::.: :.|.:|.:...|:.|
Zfish   129 ALCKVLVGFFYGNMYCSTAF--IACISVQRYWAIVHPLSQQKRNNRLAVCVSVCVWLVVWALTVP 191

  Fly   216 CLLYS--------SIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLI 272
            ..||.        .|:|.|.....|:::         ||.     .|.|.:.|:.:.:|.:|.::
Zfish   192 LYLYDQTVKVTNMDIVTCHDVTRPSQSL---------YPC-----IYFLTMGVVGFVVPCLVCIV 242

  Fly   273 CYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFI--YAYHNNQV 335
            ....|.|.|..|.:       ....::.::|.:.:.:.::.:|.:|:.|.::..:  ||...|.|
Zfish   243 SNVQMLRALKSSMN-------DPSIVQKRKKAIILIVTVLVMFLVCFTPSNIMVMVHYALLFNGV 300

  Fly   336 ASTKYVQHMYLGFY----WLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHRFDSPKSR 396
            .::.|      |||    .||..|:.|:|.:||:::..||.:.:....|      |....:.:.|
Zfish   301 KNSGY------GFYITTLCLASLNSCVDPFVYYFISDEFREHVRNTFLC------RSERTAQRMR 353

  Fly   397 LT------NKNSSNRHTRGGYTVAHS 416
            ::      :|.||...:..|.|.:.|
Zfish   354 VSFSALKYSKKSSTYTSDSGNTQSSS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 72/303 (24%)
7tm_1 100..363 CDD:278431 67/282 (24%)
f2rl1.1NP_001073273.1 7tm_1 76..326 CDD:278431 67/281 (24%)
7tm_4 <137..343 CDD:304433 56/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.