DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and gpr34b

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001122018.1 Gene:gpr34b / 791765 ZFINID:ZDB-GENE-040823-1 Length:359 Species:Danio rerio


Alignment Length:386 Identity:79/386 - (20%)
Similarity:154/386 - (39%) Gaps:86/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 AIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCV-------FNFIFM 144
            |:.:.|......|||.:.||:.......:.....||:||::||:|:  :.|:       ||    
Zfish    34 AVFYTLFFLFGFAGNLLALWVFLRLHPKKNSVRIFLINLALADILL--VICLPFRVAYHFN---- 92

  Fly   145 LNSDWPFGSIYCTI--NNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKV------RII 201
             |:.|...|:.|.|  |.|..|:.:|.::  |..||.|||:    ...|.:|||..      .|:
Zfish    93 -NNQWVLPSLLCRIVGNVFYMNMYISIAL--LGFISVDRYL----KFHRASSRRWFLQSHWSAIV 150

  Fly   202 LVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIP 266
            ..::||:|....:|.::.:....:.:...:.:.:|...|.           ||...::|..:.:.
Zfish   151 CGVLWAVSIAGVSPFIVKTENNNETHQCFQYKKLCDSKWK-----------AYFNFVIVAIFWVV 204

  Fly   267 MIVMLICYSLMGRVLWGSRSIGENTDRQ--MESMKSKRKVVRMFIAIVSIFAICWLPYH---LFF 326
            ...:::.|   ||:  |.:.|..:.|:.  ..:.|..:...:.|..:.: |.:|:.|||   :|:
Zfish   205 YGALVMSY---GRI--GMKLITASRDKPDFPNAAKYNKTAWKSFFVLFT-FTVCYAPYHFVRIFY 263

  Fly   327 IYAYHNNQVASTKY-----VQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLT 386
            |.:.....|:..|.     ...:.|   .|:..|:.::|::|:.:....|....:.||.|....|
Zfish   264 IMSQMAPNVSCNKMNVLDKTNEVVL---LLSALNSCLDPVMYFLLCSSIRKVTLKFICNCFCQQT 325

  Fly   387 RHRFDSPKSRLTNKNSSNRHTRGGYTVAHSLPNSSPPTTQTLLAVLAQTLTQPKPQTQLLL 447
            .:..                            |||......::.|:.:|:.|...:..:::
Zfish   326 NNAL----------------------------NSSSDEQPKIMTVVPKTICQDIKKATIII 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 68/308 (22%)
7tm_1 100..363 CDD:278431 64/287 (22%)
gpr34bNP_001122018.1 7tm_1 47..302 CDD:278431 64/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.