DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and hcar1-1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001156764.1 Gene:hcar1-1 / 570755 ZFINID:ZDB-GENE-111111-4 Length:328 Species:Danio rerio


Alignment Length:369 Identity:83/369 - (22%)
Similarity:155/369 - (42%) Gaps:86/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CLFPSPTRPYELPWEQKTIWA-IIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADL 130
            |.|.:|.....||   ..::: .:.|||      |||:.|.:...||......:.:|.:|::||.
Zfish     9 CAFDAPILDEVLP---PVLFSEFVLGLM------GNGLALCMFFFHRDSWKPNSIYLAHLALADS 64

  Fly   131 LMSSLNCV-FNF-IFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKR-- 191
            |:  |.|: |.. .:.....|.:|..:|.:..|:.....:..:|.|.|::.|||:.|||||.|  
Zfish    65 LV--LFCLPFRADYYRRGKHWVYGDAFCRVLLFLLAANRAAGIFFLTAVAVDRYLKIVHPLNRIN 127

  Fly   192 RTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVC-----------FMMWPDGRY 245
            :...|....:.|.:|||...::...|     ..||:|...:||.|           ...|.:..|
Zfish   128 QMGLRYALWVSVGLWALIIAMTVYLL-----ADKHFYYRNNRTQCESFNICLGHNALSDWHNSFY 187

  Fly   246 PTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIA 310
                          |:.:.:|..:::.|.:.   :.|..:  |:..|:.   .|.|| .||..:|
Zfish   188 --------------VIQFFVPTFIVIYCSTC---ITWQLK--GKTIDKH---GKIKR-AVRFVLA 229

  Fly   311 IVSIFAICWLPYH-----LFFIYAYHNNQVASTKYVQHMYLGFY---WLAMSNAMVNPLIYYW-- 365
            :..:|.||:.|.:     ::.:.::||    ..:|.|...:.||   .....|:::||::||:  
Zfish   230 VALVFIICFFPSNVSRIAVWVLKSWHN----ECQYFQDANVAFYITVCFTYFNSVLNPVVYYFSS 290

  Fly   366 --MNKRFRMYFQRIICCCCVGLTRHRFDSPKSRLTNKNSSNRHT 407
              :::..|..:.|:               ...::.:::..|.|:
Zfish   291 PAVSRSLRKIYMRM---------------SGQKIEDEHEKNNHS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 74/310 (24%)
7tm_1 100..363 CDD:278431 69/285 (24%)
hcar1-1NP_001156764.1 7tm_1 34..286 CDD:278431 69/285 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.