DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and tacr1b

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001268728.1 Gene:tacr1b / 564017 ZFINID:ZDB-GENE-091117-17 Length:412 Species:Danio rerio


Alignment Length:391 Identity:143/391 - (36%)
Similarity:225/391 - (57%) Gaps:47/391 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSIIDNRDNLESINEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVT 109
            :|..||......:|:.:.|..:  |..|.      | |..:|||.:..::.|::.||..|:||:.
Zfish    10 NSSADNGSAGSPVNDTEVFGNQ--FVQPV------W-QIVLWAIAYCTIVLVSVVGNITVIWIIL 65

  Fly   110 GHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTL 174
            .|:.|||||||||:||:.|:..||:.|.|.|||:.::::|.||.:||..:||.....|..|::::
Zfish    66 AHKRMRTVTNYFLVNLAFAEASMSAFNTVINFIYAVHNEWYFGLVYCRFHNFFPIAAVFASIYSM 130

  Fly   175 VAISFDRYIAIVHPLKRRTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKS----RTV 235
            .||:.|||:||:|||::|.|..:.::::.:||||:.:|:.|         ::|::..:    |.|
Zfish   131 TAIALDRYMAIIHPLQQRLSSAETKLVVCVIWALALMLAFP---------QYYFSSTAQLPGRVV 186

  Fly   236 CFMMWPDGRYPTSMADY--AYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESM 298
            |::.||:    .||.|:  .|.:.::||.|.:|::||...|.::|..||.|...|:::||..|.:
Zfish   187 CYINWPE----YSMWDFQKTYYVCVVVLIYFLPLLVMGCAYLVVGCFLWASEIPGDSSDRYREQL 247

  Fly   299 KSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIY 363
            .:|||||:|.|.:|..||.||||||::||.......:...:|:|.:|||..|||||:.|.||:||
Zfish   248 IAKRKVVKMMIVVVCTFATCWLPYHVYFIVHQFLPHLFEERYIQQVYLGIMWLAMSSTMYNPIIY 312

  Fly   364 YWMNKRFRMYFQRIICCC-CV------GL----TRHRFDSPKSRLTNKNSSNRHTRGGYTVAHSL 417
            ..:|.|||..||:....| ||      ||    ||:        |..:.|..|.:|...||:..:
Zfish   313 CLLNDRFRAGFQQAFSWCPCVPQGSYEGLELKSTRY--------LQTQASIFRASRMETTVSTVM 369

  Fly   418 P 418
            |
Zfish   370 P 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 116/289 (40%)
7tm_1 100..363 CDD:278431 108/268 (40%)
tacr1bNP_001268728.1 7tm_4 48..>222 CDD:304433 69/186 (37%)
7tm_1 56..312 CDD:278431 108/268 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 255 1.000 Domainoid score I2003
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 1 1.000 - - mtm6420
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.