DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and P2RY6

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001264137.1 Gene:P2RY6 / 5031 HGNCID:8543 Length:429 Species:Homo sapiens


Alignment Length:327 Identity:77/327 - (23%)
Similarity:142/327 - (43%) Gaps:53/327 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIAD 129
            |.|::....:...||.....:.|.  ||.:.:.     ::..|.|..|:: |.|..:.|||::||
Human   117 TTCVYRENFKQLLLPPVYSAVLAA--GLPLNIC-----VITQICTSRRAL-TRTAVYTLNLALAD 173

  Fly   130 LLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPL---KR 191
            ||.:....:..:.:.....||||...|.:..|:....:..|:..|..|||.||:.|.|||   .:
Human   174 LLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHK 238

  Fly   192 RTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADY-AYN 255
            |..||...::.|.:|........|..::::...:     ::||||:.:.|    |.....| .|.
Human   239 RGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQ-----RNRTVCYDLSP----PALATHYMPYG 294

  Fly   256 LIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWL 320
            :.:.|:.:.:|...:|.||.|:     ..|...::...:..:.:.:.|..||.:.:.:.|||.:|
Human   295 MALTVIGFLLPFAALLACYCLL-----ACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFL 354

  Fly   321 PYHLFFIYAYHNNQVASTKYV----------------QHMYLGFYWLAMSNAMVNPLIYYWMNKR 369
            |:|           :..|.|:                ...|.|....|.:|::::|:::|:..|:
Human   355 PFH-----------ITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKK 408

  Fly   370 FR 371
            ||
Human   409 FR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 71/300 (24%)
7tm_1 100..363 CDD:278431 66/282 (23%)
P2RY6NP_001264137.1 7tm_1 145..401 CDD:278431 66/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.