DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and CG13575

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster


Alignment Length:491 Identity:99/491 - (20%)
Similarity:175/491 - (35%) Gaps:143/491 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PSPT-RPY---------ELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLN 124
            |.|: :||         :|...::..::.:.|.:..:|..||...|: |...|.:|......|::
  Fly    27 PIPSIQPYPGVFVGDLSQLNRFKRHAFSAVVGTLFVLAFCGNLSTLY-VNSRRKLRPFFRACLIS 90

  Fly   125 LSIADLLMSSLNCVFNFIFMLNSD----WPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAI 185
            |:.:| |:||:.|..:::....:.    |..|...|....|:...:|.:...|||||:.|||:|:
  Fly    91 LACSD-LVSSIFCTVSYMAQFQAQYLQLWTIGGFMCKFVPFITTTSVLSGSLTLVAIALDRYLAV 154

  Fly   186 VHPLKRRTS--RRKVRIILVLIWALSCVLSAPCL-LYSSIMTKHYY------NGKSRTVCFMMWP 241
            :.|:....|  :|...:.::||||.|...|.|.| :|.  ..|.|.      :.:|..|...: |
  Fly   155 MRPVLGFWSPDKRFSTLSMLLIWACSIGSSGPLLGIYD--YRKIYLLDVEDSSEESEEVVTAV-P 216

  Fly   242 DGRYPTSM--------ADY---AYNLIILVLTYGIPMIV-MLICYSLMGRVLWGSRSIGENTDRQ 294
            :....|.:        .|:   .|.:|:..|.: :|.|| .|...:::.|.||..|...:....|
  Fly   217 EELVVTELEMVHMCLAGDHDVGLYYVILFTLIF-LPCIVSFLWLNAVIARQLWLRRHYHQEQQEQ 280

  Fly   295 MESMKS----------------------------------------------------------K 301
            .:..|.                                                          .
  Fly   281 HQEPKEGQFKTMANGGDLLMPSTLVSAMGVAVPFALDNTPLPPKSTVNAPGKKTTAAALAREARH 345

  Fly   302 RKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWM 366
            ||:|.:.:.::::|....||..:|.|...:.:......::  :|..|..|.:.:..:||:.|.::
  Fly   346 RKMVVVVLLMMAVFICLRLPAWVFLIMRLYGSYSEPIDWL--LYFSFGILNLFSCALNPIFYTFL 408

  Fly   367 NKRFRMY------FQRIICC------------------CCVGLTRHRFDSPKSRLTNKNSSNRHT 407
            .:..|..      .|..:.|                  ||.||....|       |.:...:| .
  Fly   409 TQTIRTLTLVKHKIQGFLGCPPGKVPDGMPTDQMDKSGCCCGLRPPTF-------TWRCHPSR-D 465

  Fly   408 RGGYTVAHSLPNSSPPTTQTLLAVLAQTLTQPKPQT 443
            |...||...:....||:.|          .||.|.:
  Fly   466 RAAATVIRDVDQPDPPSDQ----------VQPDPSS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 75/372 (20%)
7tm_1 100..363 CDD:278431 72/345 (21%)
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 37/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.