DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and moody

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster


Alignment Length:532 Identity:104/532 - (19%)
Similarity:193/532 - (36%) Gaps:129/532 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSD 148
            |..|::..|:|.|.|.||.:.:..:.....:|.|...|:::|.|||||..:|...|..:..:...
  Fly    37 TFAAVMTFLIMIVGICGNLLTVVALLKCPKVRNVAAAFIISLCIADLLFCALVLPFQGLRFVQGT 101

  Fly   149 WPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHP--LKRRTSRRKVRIILVLIWALSCV 211
            |..|.:.|.:..|:....:..|:..:..|:.:||:.|.|.  ..|...|..:.:::...|..|..
  Fly   102 WRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYG 166

  Fly   212 LSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSL 276
            :..|.||  ....:..|:.:.:| |.:|..|..:.:...       :.:..:.||.:|::.||: 
  Fly   167 MQLPTLL--GEWGRFGYDSRLQT-CSIMTDDHGHSSKTT-------LFITAFVIPCLVIIACYA- 220

  Fly   277 MGRVLW-----------------------------GSRSIGENTD-------------------- 292
              ::.|                             ||.::....:                    
  Fly   221 --KIFWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDVP 283

  Fly   293 ----------------RQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYV 341
                            |::.:.:::.::.:|.:||...|.:|:||..:..:         :.|.|
  Fly   284 ETAPSGKQQPTRVKDQREVRAKRNEWRITKMVLAIFLSFVVCYLPITIVKV---------ADKNV 339

  Fly   342 QH--MYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGL-----TRHRFDSPKSRLTN 399
            :|  :::..|.|...:|.:||:||..|||::|..::.::.|....|     ..:...|...:..:
  Fly   340 EHPSLHICSYILLYLSACINPIIYVIMNKQYRKAYKTVVFCQPARLLLPFGKTNGASSAAEKWKD 404

  Fly   400 KNSSNRHTR-------GGYTVAHSLPNS----------SPPTTQTLLAVLAQTLTQPKPQTQLLL 447
            ...||.|:|       ||...|.....:          :||..|.     ||.|........|:.
  Fly   405 TGLSNNHSRTIVSQMSGGTGAASGAGTATGTAAVAVMQTPPEVQQ-----AQALEMVSRGPDLIS 464

  Fly   448 SHHSPHP--TQP-----SAAETKSQWKRSTMETQIQQAPVTSSCREQRSAQQQQP-PGSGTNRAA 504
            ..:.|.|  |.|     :|....|.....|:...:::   .:.|..........| |.||.....
  Fly   465 KSNLPQPNVTPPPPSVLTATPNGSNSNSLTLRLPLKK---NNHCYTNSGFNSSTPSPSSGLGIGI 526

  Fly   505 VECIMERPADGS 516
            ....:.||..||
  Fly   527 SSSSIYRPGVGS 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 69/352 (20%)
7tm_1 100..363 CDD:278431 59/331 (18%)
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 31/122 (25%)
7tm_1 53..363 CDD:278431 59/331 (18%)
7tm_4 <310..380 CDD:304433 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.