DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and Gpr4

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001020851.1 Gene:Gpr4 / 308408 RGDID:1311604 Length:365 Species:Rattus norvegicus


Alignment Length:400 Identity:94/400 - (23%)
Similarity:158/400 - (39%) Gaps:97/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLS 126
            |...:.|||            .:::..:.|    |.:..|.:.||........|.....:|:|||
  Rat    14 DSRVDHLFP------------PSLYIFVIG----VGLPTNCLALWAAYRQVRQRNELGVYLMNLS 62

  Fly   127 IADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKR 191
            |||||......::...|:.:.:|..|...|.:..|:....:..|:..|..||.|||:|:.|||:.
  Rat    63 IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLAVAHPLRF 127

  Fly   192 RTSRRKVRIILV--LIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAY 254
            ...||....:.|  ::||.....::..|.:..:....|    :.|.||..:|..|:...|     
  Rat   128 ARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRY----NHTFCFEKFPMERWVAWM----- 183

  Fly   255 NLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICW 319
            ||..:.:.:..|..:||:||..:.|.:..|.|    |:||     .|.|:.|:.:::::|..:|:
  Rat   184 NLYRVFVGFLFPWALMLLCYRGILRAVQSSVS----TERQ-----EKVKIKRLALSLIAIVLVCF 239

  Fly   320 LPYHLFFIYAYHNNQVASTKYVQHMYLGFYW---------------LAMS--NAMVNPLIYYWMN 367
            .|||...:..            ..:|||..|               ||.:  |.:.:|::|..:|
  Rat   240 APYHALLLSR------------SAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVN 292

  Fly   368 KRFRMYFQRIICCCCVGLTRH---RF---DSP----------KSRLTNKNSSNRHTRGGYTVAHS 416
            :..|....:.:         |   ||   :.|          ::.||:|.|:...|.|.....  
  Rat   293 EGARSDVAKAL---------HNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKTSGAVWAV-- 346

  Fly   417 LPNSSPPTTQ 426
                 |||.|
  Rat   347 -----PPTAQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 75/302 (25%)
7tm_1 100..363 CDD:278431 71/281 (25%)
Gpr4NP_001020851.1 7tmA_GPR4 20..299 CDD:320488 79/324 (24%)
TM helix 1 22..46 CDD:320488 6/39 (15%)
TM helix 2 55..76 CDD:320488 9/20 (45%)
TM helix 3 93..115 CDD:320488 4/21 (19%)
TM helix 4 138..154 CDD:320488 3/15 (20%)
TM helix 5 181..204 CDD:320488 7/27 (26%)
TM helix 6 225..247 CDD:320488 6/21 (29%)
TM helix 7 267..292 CDD:320488 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.