DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and Gpr174

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001100408.1 Gene:Gpr174 / 302373 RGDID:1564689 Length:335 Species:Rattus norvegicus


Alignment Length:303 Identity:77/303 - (25%)
Similarity:147/303 - (48%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDW 149
            |:|:.:.:::...:.||.:.||:..|:.........|::||:||||| ..|:......:.||.||
  Rat    21 IYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVVFMINLAIADLL-QILSLPLRIFYYLNHDW 84

  Fly   150 PFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLI-WALSCVLS 213
            |||...|....::..|.:..|::.||.||..|:..:::|.:....::|..:.:.:: |.:.|:  
  Rat    85 PFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFNDCKQKYDLYISIVGWLIICL-- 147

  Fly   214 APCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIIL----VLTYGIPMIVMLICY 274
             .|||:..:.|.....| :||.||:     ..|....:.|.::.::    |:.:..|::::|.| 
  Rat   148 -ACLLFPLLRTNDDTPG-NRTKCFV-----DLPIRNVNLAQSVAMITIGEVVGFITPLMIVLYC- 204

  Fly   275 SLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFF--IYAYHNNQVAS 337
                  .|.:....:|.....:.:..|:|.:||.:...::|.||:.|||..|  .:...:|::.|
  Rat   205 ------TWKTALSLQNKYPISQHLGEKKKALRMILTCAAVFLICFAPYHFSFPLDFLVKSNEIKS 263

  Fly   338 TKYVQHMYLGFY----WLAMSNAMVNPLIYYWMNKRFRMYFQR 376
            . ..:.:.|.|:    .||..|:.::|:|||:....||....|
  Rat   264 C-LARRVILIFHSVALCLASLNSCLDPVIYYFTTNEFRRRLSR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 74/294 (25%)
7tm_1 100..363 CDD:278431 69/273 (25%)
Gpr174NP_001100408.1 7tm_1 36..292 CDD:278431 69/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.