DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and Gpr31

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001162603.1 Gene:Gpr31 / 292310 RGDID:1305187 Length:319 Species:Rattus norvegicus


Alignment Length:366 Identity:83/366 - (22%)
Similarity:141/366 - (38%) Gaps:78/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNY--FLLNLSI 127
            |.|...||.        .:|....:..|...:.:.||.:.||  |....::....|  :|.||.:
  Rat     4 TNCSAASPV--------VETAVGAMLTLECVLGLMGNAVALW--TFFYRLKVWKPYAVYLFNLVV 58

  Fly   128 ADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRR 192
            ||||:::........::....|..|...|.:..|:...:....|..|..::.|||:.::||    
  Rat    59 ADLLLATSLPFLAAFYLKGKTWKLGHTPCQVLLFLLTFSRGVGVAFLTTVALDRYLRVIHP---- 119

  Fly   193 TSRRKVRIILV--------LIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSM 249
              |.:|.::.:        |||.|..||:...||...       ..::.|.|...:|.|.   :.
  Rat   120 --RLRVNLLSLKAAWGISSLIWLLMVVLTPQNLLICK-------TTQNSTECPSFYPVGE---TK 172

  Fly   250 ADYAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKR-KVVRMFIAIV- 312
            |......::..|...||..::..|.|.:.|.|         ..|..||.|..| :..|:.:|:| 
  Rat   173 ASATCQEVLFFLQVLIPFALISFCNSELIRTL---------QKRLRESDKQPRIRRARVLVAMVL 228

  Fly   313 SIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMV----------------NPL 361
            .:|.:|:||..|             |:.:.|::..|....:..|||                :|.
  Rat   229 LLFGLCFLPSVL-------------TRVLVHIFQEFESCTVQKAMVQASDIAGSLTCLHSALSPA 280

  Fly   362 IYYWMNKRFRMYFQRIICCCCVGLTRHRFDSPKSRLTNKNS 402
            ||.:.|..|...::::: ....|: |...:||.|.|.:..|
  Rat   281 IYCFSNPAFTHSYRKVL-KSLRGM-RKVAESPSSNLRDSIS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 71/311 (23%)
7tm_1 100..363 CDD:278431 66/290 (23%)
Gpr31NP_001162603.1 7tm_1 31..282 CDD:278431 66/290 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.