DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and GPR31

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_005290.2 Gene:GPR31 / 2853 HGNCID:4486 Length:319 Species:Homo sapiens


Alignment Length:340 Identity:79/340 - (23%)
Similarity:149/340 - (43%) Gaps:77/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNY--FLLNLSIADLL 131
            ||:.:.|..:   ..|...::.||...:.:.||.:.||  |....:|....|  :||||::||||
Human     3 FPNCSAPSTV---VATAVGVLLGLECGLGLLGNAVALW--TFLFRVRVWKPYAVYLLNLALADLL 62

  Fly   132 MSSLNCV-FNFIFMLN-SDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTS 194
            :::  |: |...|.|: ..|..|.:.|...:|:.:::.|..:..|.|::.|||:.:|||      
Human    63 LAA--CLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHP------ 119

  Fly   195 RRKVRI--------ILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMAD 251
            |.||.:        :..|:|.|...|:.|.||.|..       .::.|.|...:       |.||
Human   120 RLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEA-------AQNSTRCHSFY-------SRAD 170

  Fly   252 YAYNLI----ILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIV 312
            .::::|    :..|.:.:|..:::.|.:.:.|.|       :...|:.|.....::...:...:|
Human   171 GSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRAL-------QKRLREPEKQPKLQRAQALVTLVV 228

  Fly   313 SIFAICWLP-------YHLF--------FIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLI 362
            .:||:|:||       .|:|        .....|.:.|..:            |...::::||::
Human   229 VLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGS------------LTYLHSVLNPVV 281

  Fly   363 YYWMNKRFRMYFQRI 377
            |.:.:..||..::|:
Human   282 YCFSSPTFRSSYRRV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 73/314 (23%)
7tm_1 100..363 CDD:278431 69/293 (24%)
GPR31NP_005290.2 7tm_1 70..282 CDD:278431 52/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.