DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and LPAR4

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001264929.1 Gene:LPAR4 / 2846 HGNCID:4478 Length:370 Species:Homo sapiens


Alignment Length:346 Identity:91/346 - (26%)
Similarity:161/346 - (46%) Gaps:53/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCV--FNFIFMLNSDWPF 151
            ::.::..:.:..|.:.|::......||:.|..|:.||:::|||..   |.  |...:..|..|||
Human    45 VYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFV---CTLPFKIFYNFNRHWPF 106

  Fly   152 GSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRT--SRRKVRIILVLIWALSCVLSA 214
            |...|.|:.......:..|:..|..||.||::|||:|.:.||  :||...|:...:|.|  |||.
Human   107 GDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWIL--VLSG 169

  Fly   215 PCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGR 279
            .  :.:|:.:....| .:.|.||..:....:.|.::  ...:.|.|:.:.||:|:.:.|.|::.|
Human   170 G--ISASLFSTTNVN-NATTTCFEGFSKRVWKTYLS--KITIFIEVVGFIIPLILNVSCSSVVLR 229

  Fly   280 VLWGSRS---IGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYH-LFFIYAYHNNQVAST-- 338
            .|....:   ||.|          |:||::|....:::|.:|::||: :.|:||...:|..:.  
Human   230 TLRKPATLSQIGTN----------KKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCF 284

  Fly   339 --KYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRH-RFDS---PKSRL 397
              ::.:.||.....||..|...:|.|||:..:.|:..|.         :..| |.:|   .::.|
Human   285 LERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFY---------INAHIRMESLFKTETPL 340

  Fly   398 TNKNS--------SNRHTRGG 410
            |.|.|        |::.|..|
Human   341 TTKPSLPAIQEEVSDQTTNNG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 81/295 (27%)
7tm_1 100..363 CDD:278431 76/274 (28%)
LPAR4NP_001264929.1 7tm_4 51..>165 CDD:304433 36/116 (31%)
7tm_1 57..311 CDD:278431 76/273 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.