DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and P2ry1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_036932.1 Gene:P2ry1 / 25265 RGDID:3242 Length:373 Species:Rattus norvegicus


Alignment Length:317 Identity:77/317 - (24%)
Similarity:143/317 - (45%) Gaps:47/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFN 140
            |.||        .::.|:..:...||.:.:|:...|....:..:.::.||::||.|.........
  Rat    52 YYLP--------AVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALI 108

  Fly   141 FIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKR--RTSRRKVRIILV 203
            |.:...:||.||.:.|.:..|:.:|.:..|:..|..||..||..:|:|||.  |..::....:.|
  Rat   109 FYYFNKTDWIFGDVMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSV 173

  Fly   204 LIWALSCVLSAPCLLYSSIMTKHYYNGKSRTV-CFMMWPDGRYPTSMADYAYNLIILVLTYGIPM 267
            |:|.:..|..:|.|.||....:     |::|| |:....| .|..|.  :.|::...|..:.||:
  Rat   174 LVWLIVVVAISPILFYSGTGIR-----KNKTVTCYDSTSD-EYLRSY--FIYSMCTTVAMFCIPL 230

  Fly   268 IVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYH- 331
            :::|.||.|:.|.|         ..:.:::...:||.:.:.|.::::||:.::|:|:....... 
  Rat   231 VLILGCYGLIVRAL---------IYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRA 286

  Fly   332 ------------NNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQR 376
                        |::|.:|..|..      .||..|:.|:|::|:.....||....|
  Rat   287 RLDFQTPEMCDFNDRVYATYQVTR------GLASLNSCVDPILYFLAGDTFRRRLSR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 73/299 (24%)
7tm_1 100..363 CDD:278431 69/278 (25%)
P2ry1NP_036932.1 7tm_1 68..324 CDD:278431 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.