DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and Gpr174

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_017173946.1 Gene:Gpr174 / 213439 MGIID:2685222 Length:348 Species:Mus musculus


Alignment Length:303 Identity:76/303 - (25%)
Similarity:148/303 - (48%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDW 149
            |:|:.:.:::...:.||.:.||:..|:.........|::||:||||| ..|:......:.||.||
Mouse    34 IYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVVFMINLAIADLL-QILSLPLRIFYYLNHDW 97

  Fly   150 PFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLI-WALSCVLS 213
            |||...|....::..|.:..|::.||.||..|:..:::|.:....::|..:.:.:| |.:.|:  
Mouse    98 PFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFNDCKQKYDLYISIIGWLIICL-- 160

  Fly   214 APCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIIL----VLTYGIPMIVMLICY 274
             .|||:..:.|.....| :||.||:     ..|....:.|.::.::    |:.:..|::::|.| 
Mouse   161 -ACLLFPLLRTNDDTPG-NRTKCFV-----DLPIRNVNLAQSVAMITIGEVVGFVTPLMIVLYC- 217

  Fly   275 SLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFF--IYAYHNNQVAS 337
                  .|.:....:|.....:.:..|:|.::|.:....:|.:|::|||..|  .:...:|::.|
Mouse   218 ------TWKTALSLQNKYPISQHLGEKKKALKMILTCAGVFLVCFVPYHFSFPLDFLVKSNEIKS 276

  Fly   338 TKYVQHMYLGFY----WLAMSNAMVNPLIYYWMNKRFRMYFQR 376
            . :.:.:.|.|:    .||..|:.::|:|||:....||....|
Mouse   277 C-FARRVILIFHSVALCLASLNSCLDPVIYYFTTNEFRRRLSR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 73/294 (25%)
7tm_1 100..363 CDD:278431 68/273 (25%)
Gpr174XP_017173946.1 7tmA_GPR174-like 33..316 CDD:320280 75/299 (25%)
TM helix 1 35..59 CDD:320280 5/23 (22%)
TM helix 2 68..89 CDD:320280 9/21 (43%)
TM helix 3 105..127 CDD:320280 5/21 (24%)
TM helix 4 149..165 CDD:320280 5/18 (28%)
TM helix 5 196..219 CDD:320280 4/29 (14%)
TM helix 6 239..264 CDD:320280 7/24 (29%)
TM helix 7 284..309 CDD:320280 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.