DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and P2ry1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001268945.1 Gene:P2ry1 / 18441 MGIID:105049 Length:373 Species:Mus musculus


Alignment Length:322 Identity:78/322 - (24%)
Similarity:142/322 - (44%) Gaps:57/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFN 140
            |.||        .::.|:..:...||.:.:|:...|....:..:.::.||::||.|.........
Mouse    52 YYLP--------AVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALI 108

  Fly   141 FIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKR--RTSRRKVRIILV 203
            |.:...:||.||...|.:..|:.:|.:..|:..|..||..||..:|:|||.  |..::....:.|
Mouse   109 FYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSV 173

  Fly   204 LIWALSCVLSAPCLLYSSIMTKHYYNGKSRTV-CFMMWPDGRYPTSMADY-----AYNLIILVLT 262
            |:|.:..|..:|.|.||...|:     |::|| |        |.|:..||     .|::...|..
Mouse   174 LVWLIVVVAISPILFYSGTGTR-----KNKTVTC--------YDTTSNDYLRSYFIYSMCTTVAM 225

  Fly   263 YGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFI 327
            :.||::::|.||.|:.:.|         ....:::...:||.:.:.|.::::||:.::|:|:...
Mouse   226 FCIPLVLILGCYGLIVKAL---------IYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKT 281

  Fly   328 YAYH-------------NNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQR 376
            ....             |::|.:|..|..      .||..|:.|:|::|:.....||....|
Mouse   282 MNLRARLDFQTPEMCDFNDRVYATYQVTR------GLASLNSCVDPILYFLAGDTFRRRLSR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 74/304 (24%)
7tm_1 100..363 CDD:278431 70/283 (25%)
P2ry1NP_001268945.1 7tm_1 68..324 CDD:278431 70/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.