DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and Gpr33

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_032185.1 Gene:Gpr33 / 14762 MGIID:1277106 Length:339 Species:Mus musculus


Alignment Length:340 Identity:86/340 - (25%)
Similarity:154/340 - (45%) Gaps:54/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 INEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYF 121
            ||.:.........|:|.        .|||.|....:...:.:..||:.||::. .:..|||....
Mouse    11 INVSTSLTNSTGVPTPA--------PKTIIAASLFMAFIIGVISNGLYLWMLQ-FKMQRTVNTLL 66

  Fly   122 LLNLSIADLLMSSLNCVFNFI---FMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYI 183
            ..:| |....:|:|  :..|:   |:.::.|.|||:.|...|...:|::..|||.|.|||..||.
Mouse    67 FFHL-ILSYFISTL--ILPFMATSFLQDNHWVFGSVLCKAFNSTLSVSMFASVFFLSAISVARYY 128

  Fly   184 AIVHPL---KRRTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVC---FMM--- 239
            .|:||:   :.||.....||.| .||..:.:||.|.|::.:....|    |.|..|   :::   
Mouse   129 LILHPVWSQQHRTPHWASRIAL-QIWISATILSIPYLVFRTTHDDH----KGRIKCQNNYIVSTD 188

  Fly   240 WPDGRYPTSMADYAYNLIIL---VLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSK 301
            |....:.| :..:.:....:   :|.:.:|.:|::.||..:...:           ::....||.
Mouse   189 WESKEHQT-LGQWIHAACFVGRFLLGFLLPFLVIIFCYKRVATKM-----------KEKGLFKSS 241

  Fly   302 RKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQV--ASTKYVQHMYLGFYWLAMS-NAMVNPLIY 363
            :....|..|::|.| :||:|||:      |:..|  .|.....|:.||...:.:| |.:|:|::|
Mouse   242 KPFKVMVTAVISFF-VCWMPYHV------HSGLVLTKSQPLPLHLTLGLAVVTISFNTVVSPVLY 299

  Fly   364 YWMNKRFRMYFQRII 378
            .:..:.|:::.:.|:
Mouse   300 LFTGENFKVFKKSIL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 77/301 (26%)
7tm_1 100..363 CDD:278431 75/280 (27%)
Gpr33NP_032185.1 7tm_1 47..299 CDD:278431 75/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.