DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and F2rl1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_032000.3 Gene:F2rl1 / 14063 MGIID:101910 Length:399 Species:Mus musculus


Alignment Length:333 Identity:77/333 - (23%)
Similarity:156/333 - (46%) Gaps:33/333 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLN-SDWPF 151
            :::.::..:.:..||:.|||.......:.....::.||::|||| |.:.......:.|: ::|.:
Mouse    82 VVYIIVFVIGLPSNGMALWIFLFRTKKKHPAVIYMANLALADLL-SVIWFPLKISYHLHGNNWVY 145

  Fly   152 GSIYC--TINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRI---ILVLIWALSCV 211
            |...|  .|..|..|  :..|:..:..:|..||..||:|:..  .|:|..|   :.:.||.|..:
Mouse   146 GEALCKVLIGFFYGN--MYCSILFMTCLSVQRYWVIVNPMGH--PRKKANIAVGVSLAIWLLIFL 206

  Fly   212 LSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSL 276
            ::.|..:....:   |....:.|.|..:.|:......|.:|..:|.|.|..:  |.::....|.|
Mouse   207 VTIPLYVMKQTI---YIPALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLF--PALLTASAYVL 266

  Fly   277 MGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYV 341
            |.:.| .|.::.|:::      |.:::.:|:.|.:::::.||:.|.:|..:..|...:.....:|
Mouse   267 MIKTL-RSSAMDEHSE------KKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQSHV 324

  Fly   342 QHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHRFDSPKSRLTNKNSSNRH 406
            ..:||....|:..|:.::|.:||:::|.||.:.:..:.|..|...        :|:....|||:.
Mouse   325 YALYLVALCLSTLNSCIDPFVYYFVSKDFRDHARNALLCRSVRTV--------NRMQISLSSNKF 381

  Fly   407 TR--GGYT 412
            :|  |.|:
Mouse   382 SRKSGSYS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 68/289 (24%)
7tm_1 100..363 CDD:278431 63/268 (24%)
F2rl1NP_032000.3 7tm_1 95..346 CDD:278431 63/267 (24%)
7tm_4 <156..363 CDD:304433 51/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.