DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and Tre1

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster


Alignment Length:399 Identity:84/399 - (21%)
Similarity:162/399 - (40%) Gaps:89/399 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TECLFPSPTRPYELPWEQKTIWAIIFG-LMMFVAIAGNGIVLWIVTGHRSMRT-VTNYFLLNLSI 127
            |:.::|          ...|::|.|.. :.:.:.:.||.|.|..:....::|. .|..|:::|||
  Fly    26 TQSIYP----------HSATLFAAISACVFVTIGVLGNLITLLALLKSPTIREHATTAFVISLSI 80

  Fly   128 ADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIV-HPLKR 191
            :|||..|.:.....:......|.||:..|.|...:....|:.|:.::|.|:.:|||.|. |....
  Fly    81 SDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYS 145

  Fly   192 RTSRRK-VRIILVLIWALSCVLSAPCLLYSSIMTKHYYNG--------KSRTVCFMMWPDGRYPT 247
            :..:.| :.:.|:.:||:|.:|..|.:|           |        ::...|.::..:||   
  Fly   146 QIYKPKFITLQLLFVWAVSFLLLLPPIL-----------GIWGEMGLDEATFSCTILKKEGR--- 196

  Fly   248 SMADYAYNLIILVLTYGIPMIVMLICYS-LMGRVLWGSRSIGENTDRQMESMKSK---------- 301
                 :....:.|:.:.:|.:|:::.|| :...||...:.|..:.:.|:.:.|..          
  Fly   197 -----SIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMT 256

  Fly   302 ----------RKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLGFYWL----- 351
                      .::..|.:.|...|.:|:||..|..:.....|    |.|.        ||     
  Fly   257 TTCTRKAREDNRLTVMMVTIFLCFLVCFLPLMLANVVDDERN----TSYP--------WLHIIAS 309

  Fly   352 --AMSNAMVNPLIYYWMNKRF--RMYFQRIICCCCVGLTRHRFDSPKSRLTNKN---SSNRHTRG 409
              |.:::::||:||...|:.:  .:::.|:.......|.:. :..|.|.:.::|   |.|.....
  Fly   310 VMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFALLKF-WGEPLSPMPSRNYHQSKNSKELS 373

  Fly   410 GYTVAHSLP 418
            |  |..|.|
  Fly   374 G--VIRSTP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 68/324 (21%)
7tm_1 100..363 CDD:278431 65/301 (22%)
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 65/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.