DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and si:dkey-78k11.9

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_009295208.2 Gene:si:dkey-78k11.9 / 100537284 ZFINID:ZDB-GENE-060503-929 Length:364 Species:Danio rerio


Alignment Length:375 Identity:92/375 - (24%)
Similarity:153/375 - (40%) Gaps:97/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VVSLLSSIIDNR---DNLESINEAK--------DFLTECLFPSPTRPYELPWEQKTIWAIIFGLM 93
            ::.|.::|..:|   |:|..|.|:.        || |....||             ::..:|.| 
Zfish    20 ILHLKTAITPSRTSDDHLLPIMESNSTCKLVNFDF-TFRFLPS-------------VYVSVFTL- 69

  Fly    94 MFVAIAGNGIVL------WIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFG 152
               .:.||.:.|      |...|:      .|.|:|||..||:|.......|...:.....|.||
Zfish    70 ---GVMGNCLGLKSIYKNWTKMGN------VNIFMLNLCGADILYLLTLPFFVVYYASEHKWIFG 125

  Fly   153 SIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLK---RRTSRRKVRIILVLIWALSCVLSA 214
            ..:|.|......:.:..|:..|..||..||:.|||.|:   |.|:|..| ::.:|:|.|..:.|.
Zfish   126 HAFCKILRLCFCINLYGSIGFLTCISVYRYLGIVHTLRVKGRITARFSV-LVALLVWLLVLLQSL 189

  Fly   215 PCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADY-AYNLIILVLTYGIPMIVMLICYSLMG 278
            |.|.:..       ...:.|.|:....| :|   |.:| .|::...|:.:|||:::||.||..:.
Zfish   190 PDLFFVK-------TSDNATSCYDTTSD-KY---MREYLKYSIGRTVVGFGIPLLIMLCCYGHVA 243

  Fly   279 RVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLF------------------ 325
            ..|...:.|         .:..|.:.:|:.:.::.:|:||:.|:|:|                  
Zfish   244 FTLLTKKDI---------DIILKLRCLRLVVILILLFSICFTPFHIFRNMNLATRISKLDGTCLK 299

  Fly   326 -FIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYF 374
             :...|..|||.:            .||..|:.:|||:|.:.:..|.|.|
Zfish   300 WYADVYIANQVGN------------GLACMNSAINPLLYLFNSDEFLMKF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 79/312 (25%)
7tm_1 100..363 CDD:278431 74/291 (25%)
si:dkey-78k11.9XP_009295208.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.