DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and LOC100535282

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_009294045.1 Gene:LOC100535282 / 100535282 -ID:- Length:344 Species:Danio rerio


Alignment Length:342 Identity:69/342 - (20%)
Similarity:151/342 - (44%) Gaps:62/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IWAIIFGLMMFVAIAGNGIVLWIVTGHRSMR-----TVTNYFLLNLSIADLLMS----SLNCVFN 140
            ::...:.:::.:...||.:|:.:| |...:|     ..::..|:|:::::|::|    ||..:.:
Zfish    19 LYIAFYVILVLLGNLGNSLVIGVV-GEGLLREPGVARSSDIILVNMALSNLMVSLTRNSLLVISD 82

  Fly   141 F---IFMLNSDWP--FGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSR----R 196
            .   :| ||.:|.  ...|:..:.:  |||   .|.|.|.|..|.....:..|:......    |
Zfish    83 MGVQVF-LNRNWCRFMMGIWVWVRS--ANV---WSTFFLSAFHFQTLRRVAPPVSNVHGHPGPPR 141

  Fly   197 KVRIILVLIWALSCVLSAPCLLYS------SIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYN 255
            .:...|.|||:|:.:.|.|..::|      |..|....:..:|.:...:|   .:|::.:..|:.
Zfish   142 SLIFGLCLIWSLNLIYSIPAFIFSKNGDANSTETLMLVSSTTRPLLGCIW---NFPSAYSGLAFA 203

  Fly   256 LIILVLTYGIPMIVMLICYSLMGRVL------WGSRSIGENTDRQMES-MKSKRKVVRMFIAIVS 313
            ...::|...||:.:|.|  :.||.:|      ...|:..:::|..:.| :.::|:..::.:|:..
Zfish   204 TSSMILHESIPICLMSI--TNMGSLLALYAHGEARRAAKKSSDAPVVSRIPAERRAAKVILALNI 266

  Fly   314 IFAICWLPYHLFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVN-------PLIYYWMNKRFR 371
            :|.:.| ...:..:..::.|:.:||.          ||.::..:.|       |::....::|.|
Zfish   267 LFILSW-GTSVISVNYFNYNRGSSTD----------WLLIAARIGNITFIALSPIVLAVGHRRLR 320

  Fly   372 MYFQRIICCCCVGLTRH 388
            .:...|: ...:.|.||
Zfish   321 AFLASIL-THSIALCRH 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 65/321 (20%)
7tm_1 100..363 CDD:278431 63/300 (21%)
LOC100535282XP_009294045.1 7tm_1 34..272 CDD:278431 55/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.