DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and tacr3

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_002934808.1 Gene:tacr3 / 100486525 XenbaseID:XB-GENE-985728 Length:431 Species:Xenopus tropicalis


Alignment Length:305 Identity:125/305 - (40%)
Similarity:196/305 - (64%) Gaps:15/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIF 143
            || :..:|::.:|.|:.||:.||.||:||:..|:.|||||||||:||:.:|..|::.|.:.|||:
 Frog    46 PW-RIALWSLAYGSMVAVAVFGNIIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIY 109

  Fly   144 MLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLIWAL 208
            .|:::|.||..||..:||....::..|::::.||:.|||:||:.|||.|.|....::::..||..
 Frog   110 ALHNEWYFGEAYCRFHNFFPITSIFASIYSMSAIAVDRYMAIIDPLKPRLSATSTKVVIGSIWIF 174

  Fly   209 SCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWP--DGRYPTSMADYAYNLIILVLTYGIPMIVML 271
            :.:|:.|..|||.|...     ::||:|.::||  |.|       ..|..|:::|.|.:|:|||.
 Frog   175 AILLAFPQCLYSKIRVT-----RTRTLCMLVWPGKDER-------LTYQFILVLLVYVLPLIVMG 227

  Fly   272 ICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVA 336
            :.|:::|..|||....|:.:|:..|.:::|||||:|.|.:|..|||||||||:||:....:.::.
 Frog   228 VTYTIVGITLWGGEIPGDTSDKYHEQLRAKRKVVKMMIVVVVTFAICWLPYHIFFLADALDIKLD 292

  Fly   337 STKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCC 381
            ..||:|.:||..:|||||:.|.||:||..:|||||..|:|....|
 Frog   293 RWKYIQQIYLAIFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 119/285 (42%)
7tm_1 100..363 CDD:278431 108/264 (41%)
tacr3XP_002934808.1 7tm_4 58..>181 CDD:304433 51/122 (42%)
7tm_1 66..319 CDD:278431 108/264 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 246 1.000 Domainoid score I2128
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 1 1.000 - - mtm9492
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.