DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR86C and oxgr1a.2

DIOPT Version :9

Sequence 1:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001139097.1 Gene:oxgr1a.2 / 100004138 ZFINID:ZDB-GENE-090312-1 Length:338 Species:Danio rerio


Alignment Length:376 Identity:93/376 - (24%)
Similarity:156/376 - (41%) Gaps:72/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWI-VTGHRSMRTVTNYF 121
            |.:.|..|:  ..|..:.|.||        .::|.:..|.:.||...|.: :...|..::.| ..
Zfish    11 NTSSDNCTD--VDSKMKRYYLP--------AMYGAIFIVGVIGNITALLVYLLKVRPWKSST-II 64

  Fly   122 LLNLSIADLL-MSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAI 185
            ::||.:.||| |.||..:. :.::||..|..|...|....|:.:..:..|:..|..:|..||:||
Zfish    65 MVNLVLTDLLFMISLPFLV-YYYVLNDSWTLGITVCRFARFIFHFNLYGSILFLSCVSIFRYVAI 128

  Fly   186 VHPLKRRTSRRKVR---IILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCF------MMWP 241
            |||......||| |   :..||:|.::....:| :||  ::.....|.::....|      .:||
Zfish   129 VHPQHSHKIRRK-RWGVVSCVLVWVITLAELSP-ILY--VLDTVDLNNETHCSDFASNNPQRVWP 189

  Fly   242 DGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGE-NTDRQMESMKSKRKVV 305
                        |:.::.||.|.:|::|:..||       |  |.|.| .....|.|.|..| ..
Zfish   190 ------------YSWVLTVLGYLVPLMVVCACY-------W--RIIVELKKGPHMGSTKRVR-AR 232

  Fly   306 RMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYV--QHMYLGFYW---LAMSNAMVNPLIYYW 365
            |:.:.|::.|.||:||||:...:..:.........:  |.:::.:..   :|:.|.:.|..:|..
Zfish   233 RLIVLILTCFTICFLPYHVLRAFRVYTRLTPGMNCMLDQGIHVAYIISRPIAVLNIIFNLPLYTL 297

  Fly   366 MNKRFRMYFQRIICCCCVGLTRHRFDSPKSRLTNKNSSNRHTRGGYTVAHS 416
            .:..|:..|..:..|          |..|       |||..|.|.....|:
Zfish   298 SDDSFKQAFVELFKC----------DKLK-------SSNEKTTGDDLPTHN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 76/300 (25%)
7tm_1 100..363 CDD:278431 72/279 (26%)
oxgr1a.2NP_001139097.1 7tm_1 43..291 CDD:278431 71/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.