DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4073 and SUPT5H

DIOPT Version :10

Sequence 1:NP_650010.1 Gene:CG4073 / 41284 FlyBaseID:FBgn0037827 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_003160.2 Gene:SUPT5H / 6829 HGNCID:11469 Length:1087 Species:Homo sapiens


Alignment Length:132 Identity:35/132 - (26%)
Similarity:56/132 - (42%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPNPTPRSSTGLR-KPTGQRST-------PPPRPPPHVPAPAPPP--HEPAKPYGESPGLLSPVA 57
            :|:|:|:|...:. .|.|.::|       |.|.|..:..:|:|.|  :.|..|...|||..:|..
Human   903 QPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHT 967

  Fly    58 SSGPLRQRSSVHLRKKHLGWV-----------YLIHAVLSASAVIQLVVLRLCN---KDFGELIS 108
            ....:.|.||        .||           ||...|:..:.||:.|...:|:   ||..:::|
Human   968 PGSGIEQNSS--------DWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVS 1024

  Fly   109 PS 110
            .|
Human  1025 IS 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4073NP_650010.1 None
SUPT5HNP_003160.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
Spt5_N <93..172 CDD:463406
Interaction with SUPT4H1 176..270
NGN_Euk 178..265 CDD:193577
KOW_Spt5_1 276..313 CDD:240505
Interaction with RNA polymerase II 313..420
UBR5-degron. /evidence=ECO:0000269|PubMed:37478862 328..334
KOW_Spt5_2 420..470 CDD:240506
KOW_Spt5_3 471..521 CDD:240507
KOW_Spt5_4 597..639 CDD:240508
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 670..700
KOW_Spt5_5 702..751 CDD:240509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..978 22/82 (27%)
9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ], motif CTR1 754..817
CTD 772..889 CDD:215026
PHA03269 825..>970 CDD:165527 19/66 (29%)
10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y, motif CTR2 844..950 13/46 (28%)
KOW_Spt5_6 1028..1084 CDD:240510
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.