DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14689 and Ppp1r36

DIOPT Version :9

Sequence 1:NP_650009.1 Gene:CG14689 / 41283 FlyBaseID:FBgn0037826 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001156575.1 Gene:Ppp1r36 / 210762 MGIID:2684916 Length:411 Species:Mus musculus


Alignment Length:400 Identity:92/400 - (23%)
Similarity:155/400 - (38%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PKYYS--------------------GKWSWSAEKDCLEFEPHNDLENARERYITTNGYKFLRI-I 54
            |::||                    |.|.|..|...|||:........:|:........|..: .
Mouse    11 PEFYSRRKQFVGQSSTRLDQCGLRLGMWYWKDETKTLEFKSFTPAIELKEKGKKGKAVHFAEMDS 75

  Fly    55 DQEEELIFRQAYVRDTGT-------YDFDTLVINDIRDLVLFLMPSDFLTYR---FVEFMHRPAV 109
            ...|.|..::...||...       .....:.::|:: .|..|...|....|   |..|:....:
Mouse    76 GASERLTDKRFASRDEKAAKALEKRSQQGNVTLDDVK-FVALLSLQDTEMQRICSFTTFLRNKNL 139

  Fly   110 HRLIHALIIYFEYFLRMVEFV---------LVRRDELADQIQSDQTIDMKKTFSIYLSQYRLLVA 165
            ...:.||:.|..|:|:.:...         |:.:.|:  ::..::..|.:|    ||:|      
Mouse   140 DSFLMALLYYLSYYLQRLSMEKNPQSRVVGLIEKKEV--ELVVNKLEDAQK----YLAQ------ 192

  Fly   166 RNYSVILKGEGDMAKYYHM---KEIINISDTSRDRVFHEQFLAVMTQIVWICMHRRAYNVIEMEM 227
             .|.:::.|.| ||..:|:   ||  .||||.:|..|.|.|....|.|.||...|:....||.|:
Mouse   193 -KYCILVLGLG-MADKHHLSCGKE--KISDTQKDWKFFESFYTFCTCIAWIVFRRQYLTEIEEEV 253

  Fly   228 NRLFRSDHFVMARPEY--------------------LSFTPAERSLLYGRNHKIVNYRTQI-SPL 271
            .||||::.|.:.|.::                    ::..||.:        |.|:.|:.: |.|
Mouse   254 GRLFRTNMFNIPRRKHEDEASGGEKKRMTLVQFRRMMAKRPAIK--------KAVDMRSPVLSTL 310

  Fly   272 VQELEHVAEEDMPILWIGERKYRGNDKRIAEMELEYIVPGPQLRMIDVAH------GILGHPKDL 330
            :..|...|:.      |.|:||      :|.::|:   |..:..:.|:..      ||||.|::|
Mouse   311 LPSLREKAQH------ITEKKY------VAGIKLQ---PREENIITDLESVAMPIVGILGEPRNL 360

  Fly   331 Y--NTILDLD 338
            :  ||:|.|:
Mouse   361 FNPNTLLPLE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14689NP_650009.1 PPPI_inhib 35..373 CDD:291556 82/355 (23%)
Ppp1r36NP_001156575.1 PPPI_inhib 67..400 CDD:291556 81/343 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845740
Domainoid 1 1.000 62 1.000 Domainoid score I10281
eggNOG 1 0.900 - - E1_29A0D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5343
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.