DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14689 and ppp1r36

DIOPT Version :9

Sequence 1:NP_650009.1 Gene:CG14689 / 41283 FlyBaseID:FBgn0037826 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_002938846.2 Gene:ppp1r36 / 100497339 XenbaseID:XB-GENE-5959802 Length:420 Species:Xenopus tropicalis


Alignment Length:392 Identity:87/392 - (22%)
Similarity:139/392 - (35%) Gaps:117/392 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TPKYYSGKWSWSAEKDCLEFE---PHNDLENARERYITTNGYKFLRIIDQEEELIF--------- 62
            |.|...|.|.|..:...|||.   .:|...::|||........|...:.:..:..|         
 Frog     4 TIKPNPGHWFWKEDTKTLEFSRYMSNNAFTDSRERIKKGRAIHFQDNLTKAPDSYFCALPGAKSP 68

  Fly    63 ----------RQAYVRDTGTYDFDTLVINDIRDLVLFLMPS---DFLTYRFVEFMHRPAVHRLIH 114
                      |||..||      :.:.:.|::.:.|.|:..   ..:| .|...:....:...:.
 Frog    69 IFNDRMPKSPRQANKRD------EYVTLEDVKCVALNLLQEQERQCIT-SFSTAVRSQLLDEFLM 126

  Fly   115 ALIIYFEYFLR-----------MVEFVLVRRDELADQIQSDQTIDMKKTFSIYLSQYRLLVARNY 168
            ||:.|...:|:           |:...:..:.|:.:.:...::.         |..:    |..|
 Frog   127 ALLYYLSCYLQKHSLETKPKSLMLNPSIFEKQEITEVLTRMESA---------LKHF----AHLY 178

  Fly   169 SVILKGEGDMAKYYHMKEIIN-ISDTSRDRVFHEQFLAVMTQIVWICMHRRAYNVIEMEMNRLFR 232
            .:|:.||| |.:.:||....| .|.|::||.|:|...:....|.|:...|:..||||.|:.||.|
 Frog   179 CIIVLGEG-MMEQHHMACGKNKASATNKDRRFYECLYSYCIYIAWVVFRRKDLNVIEEEVGRLLR 242

  Fly   233 SDHFVMA-RPE----------YLSFTPAERSLLYGRNHK-------IVNYRTQISPLVQELEHVA 279
            |:.|..| ||:          |:....:::...|..|.|       |.:..||.||.:..|    
 Frog   243 SNAFNPALRPKDVPKDQSWNIYVEKKKSKKKTTYVENRKESIKRPAIKSILTQCSPTLTSL---- 303

  Fly   280 EEDMPILWIGERKYRGNDKRIAEMELEYIV------PGPQLRMIDVAH-------------GILG 325
                    |...|.|.|          |:.      |..||.:.|..:             ||||
 Frog   304 --------IPSPKERSN----------YLFHKHTLHPSSQLGVSDTVNWLDMSPSFITPRIGILG 350

  Fly   326 HP 327
            .|
 Frog   351 EP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14689NP_650009.1 PPPI_inhib 35..373 CDD:291556 78/364 (21%)
ppp1r36XP_002938846.2 PPPI_inhib 33..>251 CDD:373369 52/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1188799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.