DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31278 and PDF1A

DIOPT Version :9

Sequence 1:NP_731494.1 Gene:CG31278 / 41282 FlyBaseID:FBgn0051278 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_563974.1 Gene:PDF1A / 838109 AraportID:AT1G15390 Length:269 Species:Arabidopsis thaliana


Alignment Length:227 Identity:82/227 - (36%)
Similarity:109/227 - (48%) Gaps:33/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CRS--FGTSPPANQSFRKWYQHLWTTERTNLPPYN------------------------HFTQIG 55
            |||  |..|.|.:       .||...:..|||..:                        .....|
plant    30 CRSIRFPVSRPGS-------SHLLNRKLYNLPTSSSSSLSTKAGWLLGLGEKKKKVDLPEIVASG 87

  Fly    56 DPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQIGVSLRIIAMEFKGRIRKELP 120
            ||||.::|..|....:.|..|:.|::.|:||:|....||:|||||||.||||.:|.........|
plant    88 DPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPGVGLAAPQIGVPLRIIVLEDTKEYISYAP 152

  Fly   121 EAVYQARQMSELPLTIFINPVLTVTNYAKLKHPEGCMSVRGYSAEVERFEGVKLTGLDQLGNQSE 185
            :....|::.....|.:.:||||...:..|....|||:||.|:.|.|||:..|.:||.|:.|.:.|
plant   153 KEEILAQERRHFDLMVMVNPVLKERSNKKALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIE 217

  Fly   186 LALSGWNARIAQHEMDHLEGKLYTDHMDRSTF 217
            :..|||.|||.|||.|||:|.||.|.|...||
plant   218 VNASGWQARILQHECDHLDGNLYVDKMVPRTF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31278NP_731494.1 Pep_deformylase 50..216 CDD:279645 69/165 (42%)
PDF1ANP_563974.1 Pep_deformylase 83..240 CDD:238271 65/156 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 131 1.000 Domainoid score I1684
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69354
Inparanoid 1 1.050 134 1.000 Inparanoid score I1846
OMA 1 1.010 - - QHG59626
OrthoDB 1 1.010 - - D1532656at2759
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm3583
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - LDO PTHR10458
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.