DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31278 and PDF1B

DIOPT Version :9

Sequence 1:NP_731494.1 Gene:CG31278 / 41282 FlyBaseID:FBgn0051278 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001332718.1 Gene:PDF1B / 831318 AraportID:AT5G14660 Length:273 Species:Arabidopsis thaliana


Alignment Length:157 Identity:48/157 - (30%)
Similarity:79/157 - (50%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQIGVSLRIIAMEFKGRIRKELP 120
            ||:||.:...:   .:....:|.:|:.|..|:.|.|.:|::|||:|::::::...          
plant    88 DPILRAKNKRI---DIFDENLKNLVDAMFDVMYKTDGIGLSAPQVGLNVQLMVFN---------- 139

  Fly   121 EAVYQARQMSELPLTIFINPVLTVTNYAKLKHPEGCMSVRGYSAEVERFEGVKLTGLDQLGNQSE 185
                .|.:..|....:.:||.:...:...:...|||:|..|..|||.|.:.||:...|..|.:..
plant   140 ----PAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDARDITGERFS 200

  Fly   186 LALSGWNARIAQHEMDHLEGKLYTDHM 212
            ::||...|||.|||.|||||.|:.|.|
plant   201 ISLSRLPARIFQHEYDHLEGVLFFDRM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31278NP_731494.1 Pep_deformylase 50..216 CDD:279645 48/157 (31%)
PDF1BNP_001332718.1 Pep_deformylase 83..223 CDD:238271 45/151 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1532656at2759
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101584
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.