DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31278 and Pdf

DIOPT Version :9

Sequence 1:NP_731494.1 Gene:CG31278 / 41282 FlyBaseID:FBgn0051278 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_001073696.3 Gene:Pdf / 690214 RGDID:1582894 Length:254 Species:Rattus norvegicus


Alignment Length:181 Identity:81/181 - (44%)
Similarity:114/181 - (62%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPYNHFTQIGDPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQIGVSLRIIAME 110
            |||....|:||||||..||.|..:.:|.||::.:||::|:|:|:..|||::|||:||.|:::.:|
  Rat    73 PPYTRVCQVGDPVLRTVAAPVEPKQLAGPELQRLVEQLVQVMRRRGCVGLSAPQLGVPLQVLVLE 137

  Fly   111 FKGRIRKELPEAVYQARQMSELPLTIFINPVLTVTNYAKLKHPEGCMSVRGYSAEVERFEGVKLT 175
            |..|:.:.....:.:.|||...||.:.:||.|.|.:...:..||||.||.|:.|.|.||:.|:::
  Rat   138 FPDRLFRAFSPRLRELRQMEPFPLRVLVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQIS 202

  Fly   176 GLDQLGNQSELALSGWNARIAQHEMDHLEGKLYTDHMDRSTFACTCWEAVN 226
            |||..|.....:.|||.|||.|||||||.|.|:.|.||..||....|..||
  Rat   203 GLDPKGEPVVWSASGWTARIIQHEMDHLHGCLFIDKMDSGTFTNLHWMEVN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31278NP_731494.1 Pep_deformylase 50..216 CDD:279645 73/165 (44%)
PdfXP_001073696.3 Pep_deformylase 78..235 CDD:238271 69/156 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354327
Domainoid 1 1.000 151 1.000 Domainoid score I4256
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69354
Inparanoid 1 1.050 167 1.000 Inparanoid score I4071
OMA 1 1.010 - - QHG59626
OrthoDB 1 1.010 - - D1532656at2759
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm44804
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - LDO PTHR10458
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.