DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31278 and Pdf

DIOPT Version :9

Sequence 1:NP_731494.1 Gene:CG31278 / 41282 FlyBaseID:FBgn0051278 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_080789.2 Gene:Pdf / 68023 MGIID:1915273 Length:231 Species:Mus musculus


Alignment Length:181 Identity:84/181 - (46%)
Similarity:116/181 - (64%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPYNHFTQIGDPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQIGVSLRIIAME 110
            |||.|..|:||||||..||.|..|.:|.||::.:|.|||:|:|:..|||::|||:||.|:::|:|
Mouse    50 PPYAHVCQVGDPVLRVVAAPVEPEQLAGPELQRLVGRMVQVMRRRGCVGLSAPQLGVPLQVLALE 114

  Fly   111 FKGRIRKELPEAVYQARQMSELPLTIFINPVLTVTNYAKLKHPEGCMSVRGYSAEVERFEGVKLT 175
            |..::.:.....:.:.|||...||.:.:||.|.|.:...:..||||.||.|:.|.|.||:.|:::
Mouse   115 FPDKLLRAFSPRLRELRQMEPFPLRVLVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQIS 179

  Fly   176 GLDQLGNQSELALSGWNARIAQHEMDHLEGKLYTDHMDRSTFACTCWEAVN 226
            |||..|.....:.|||.|||.|||||||:|.|:.|.||..||....|..||
Mouse   180 GLDPKGEPVVWSASGWTARIIQHEMDHLQGCLFIDKMDSGTFTNLHWMEVN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31278NP_731494.1 Pep_deformylase 50..216 CDD:279645 76/165 (46%)
PdfNP_080789.2 Pep_deformylase 55..212 CDD:238271 71/156 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850629
Domainoid 1 1.000 154 1.000 Domainoid score I4248
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69354
Inparanoid 1 1.050 172 1.000 Inparanoid score I4085
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59626
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm42740
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - LDO PTHR10458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.