DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31278 and PDF

DIOPT Version :9

Sequence 1:NP_731494.1 Gene:CG31278 / 41282 FlyBaseID:FBgn0051278 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_071736.1 Gene:PDF / 64146 HGNCID:30012 Length:243 Species:Homo sapiens


Alignment Length:210 Identity:89/210 - (42%)
Similarity:126/210 - (60%) Gaps:9/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GTSPPANQSFRKWYQHLWTTERTNL----PPYNHFTQIGDPVLRQQAALVPKEHMASPEIKAIVE 81
            |...||.:  |.:::||   .|..|    ||::|..|:||||||..||.|.:..:..||::.:.:
Human    38 GVEGPALR--RSYWRHL---RRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQ 97

  Fly    82 RMVKVLRKFDCVGIAAPQIGVSLRIIAMEFKGRIRKELPEAVYQARQMSELPLTIFINPVLTVTN 146
            |:|:|:|:..|||::|||:||..:::|:|....:.:|.|......|||...||.:|:||.|.|.:
Human    98 RLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLD 162

  Fly   147 YAKLKHPEGCMSVRGYSAEVERFEGVKLTGLDQLGNQSELALSGWNARIAQHEMDHLEGKLYTDH 211
            ...:..||||.||.|:.|.|.||:.|:::|||..|.|.....|||.|||.|||||||:|.|:.|.
Human   163 SRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDK 227

  Fly   212 MDRSTFACTCWEAVN 226
            ||..||....|..||
Human   228 MDSRTFTNVYWMKVN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31278NP_731494.1 Pep_deformylase 50..216 CDD:279645 74/165 (45%)
PDFNP_071736.1 Pep_deformylase 67..224 CDD:238271 69/156 (44%)
Hydrophobic dimerization interface 165..175 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160277
Domainoid 1 1.000 149 1.000 Domainoid score I4418
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69354
Inparanoid 1 1.050 166 1.000 Inparanoid score I4173
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59626
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm40666
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - LDO PTHR10458
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17325
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.