DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31278 and CG31373

DIOPT Version :9

Sequence 1:NP_731494.1 Gene:CG31278 / 41282 FlyBaseID:FBgn0051278 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_731495.1 Gene:CG31373 / 318700 FlyBaseID:FBgn0051373 Length:196 Species:Drosophila melanogaster


Alignment Length:193 Identity:112/193 - (58%)
Similarity:141/193 - (73%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPYNHFTQIGDPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQIGVSLRIIAME 110
            |||.||||||||||||:|..||.|.:.|.||..|::.||||||.:||||:||||:|:.||||.||
  Fly     4 PPYRHFTQIGDPVLRQRAEEVPPEDIDSREINQIIDGMVKVLRHYDCVGVAAPQVGIPLRIIVME 68

  Fly   111 FKGRIRKELPEAVYQARQMSELPLTIFINPVLTVTNYAKLKHPEGCMSVRGYSAEVERFEGVKLT 175
            |:...:::....:|:.|:||.|||.:||||.|.:.:....||||||||||||||||||::.|::.
  Fly    69 FREGKQEQFKPEIYEERKMSILPLAVFINPELEIISSQVNKHPEGCMSVRGYSAEVERYDKVRIR 133

  Fly   176 GLDQLGNQSELALSGWNARIAQHEMDHLEGKLYTDHMDRSTFACTCWEAVNTKSGRVEIPFYK 238
            |:.:||..||:.|.||||||||||:|||.|.:|.|.||.|||.|..||.:|...||..|.|:|
  Fly   134 GIGKLGTPSEMELEGWNARIAQHEVDHLNGTIYMDRMDLSTFNCILWEQINAAEGRSAIWFHK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31278NP_731494.1 Pep_deformylase 50..216 CDD:279645 97/165 (59%)
CG31373NP_731495.1 Pep_deformylase 7..171 CDD:279645 95/163 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472939
Domainoid 1 1.000 131 1.000 Domainoid score I1684
eggNOG 1 0.900 - - E1_COG0242
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1846
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59626
OrthoDB 1 1.010 - - D1532656at2759
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm25926
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - P PTHR10458
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17325
SonicParanoid 1 1.000 - - X4178
1312.840

Return to query results.
Submit another query.