DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and folD

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_415062.1 Gene:folD / 945221 ECOCYCID:EG10328 Length:288 Species:Escherichia coli


Alignment Length:291 Identity:119/291 - (40%)
Similarity:170/291 - (58%) Gaps:12/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AKIISGTAVAKSIREELRNEVTA-MSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDA 101
            ||||.|..:|:.:|.|:..:|.| ::..|.  .|||.:|.||....|.:|:..|.||..|:|..:
E. coli     3 AKIIDGKTIAQQVRSEVAQKVQARIAAGLR--APGLAVVLVGSNPASQIYVASKRKACEEVGFVS 65

  Fly   102 AHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNE 166
            ....||.:.:|.|||:.|:.||.|..:.||:||:||...  ||:.::.:.:.|:|||||.|..|.
E. coli    66 RSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAG--IDNVKVLERIHPDKDVDGFHPYNV 128

  Fly   167 GRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSK 231
            |||. .......||||.|.:.|:.|..::..|..|||:|.|.|||.|.:..|..|..|.||.|..
E. coli   129 GRLC-QRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRF 192

  Fly   232 TRNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLVGDVDYAEALQ 296
            |:||.....:||:|:|.:|....:.|.|||.||:|||.|||      :....|:||||.:.:|.:
E. coli   193 TKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGIN------RLENGKVVGDVVFEDAAK 251

  Fly   297 VAGHLTPVPGGVGPMTVAMLMKNTVRSAARF 327
            .|.::|||||||||||||.|::||:::...:
E. coli   252 RASYITPVPGGVGPMTVATLIENTLQACVEY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 118/290 (41%)
THF_DHG_CYH 40..159 CDD:279147 43/119 (36%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 77/169 (46%)
FTHFS 350..968 CDD:279592
folDNP_415062.1 PRK10792 1..285 CDD:236760 119/291 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - O PTHR48099
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.