DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and MTD1

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_013006.3 Gene:MTD1 / 853955 SGDID:S000001788 Length:320 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:82/338 - (24%)
Similarity:128/338 - (37%) Gaps:88/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDAAH 103
            :.|..:.||::...|:.|.|....|......|.|..........:.:|.....|.:..:|.   .
Yeast     6 RTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGF---R 67

  Fly   104 VQLPRSITEVELLDK-INDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTV--- 164
            ..| |.|.:.:.|:: |...|.|..|:||:|..|:..:.  ....:...|..||||:||:.|   
Yeast    68 YDL-RVIEDKDFLEEAIIQANGDDSVNGIMVYFPVFGNA--QDQYLQQVVCKEKDVEGLNHVYYQ 129

  Fly   165 ----------NEGRLAIGDLGGFLPCTPWGCLELIR---------RSGVEIAGARAVVLGRSKIV 210
                      .|.||.     ..|||||...::::.         ..|..:.|.:.:|:.||:||
Yeast   130 NLYHNVRYLDKENRLK-----SILPCTPLAIVKILEFLKIYNNLLPEGNRLYGKKCIVINRSEIV 189

  Fly   211 GTPAAELLKWANATVTVCHSKTRNLEEITR---------------------------SADILVVG 248
            |.|.|.||  ||...||......|:::.||                           .:|:::.|
Yeast   190 GRPLAALL--ANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEYSEDLLKKCSLDSDVVITG 252

  Fly   249 IGVAEMVK--GSWIKPGAVVID--CGINVKPDASKASGSKLVGDVDYAEALQVAGHLTPVPGGVG 309
            : .:|..|  ..:||.|||.|:  |..|...|..                 :.|....|:.|.| 
Yeast   253 V-PSENYKFPTEYIKEGAVCINFACTKNFSDDVK-----------------EKASLYVPMTGKV- 298

  Fly   310 PMTVAMLMKNTVR 322
              |:|||::|.:|
Yeast   299 --TIAMLLRNMLR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 82/338 (24%)
THF_DHG_CYH 40..159 CDD:279147 28/119 (24%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 57/222 (26%)
FTHFS 350..968 CDD:279592
MTD1NP_013006.3 THF_DHG_CYH 8..121 CDD:395619 28/118 (24%)
NAD_bind_m-THF_DH 116..316 CDD:133447 57/222 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.875 Normalized mean entropy S317
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.