DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and EMB3127

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_191971.1 Gene:EMB3127 / 825824 AraportID:AT4G00620 Length:360 Species:Arabidopsis thaliana


Alignment Length:291 Identity:156/291 - (53%)
Similarity:204/291 - (70%) Gaps:4/291 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GAKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDA 101
            ||.:|.|.||||.||:|:..||:.| |:....:|||.::.||.|:||..|:|.|.||...:||.:
plant    68 GAIVIDGKAVAKKIRDEITIEVSRM-KESIGVIPGLAVILVGDRKDSATYVRNKKKACDSVGIKS 131

  Fly   102 AHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNE 166
            ..|:|....:|.|:|..::..|:||.||||:||:||  .:.:|...|.:|||.||||||.|.:|.
plant   132 FEVRLAEDSSEEEVLKSVSGFNDDPSVHGILVQLPL--PSHMDEQNILNAVSIEKDVDGFHPLNI 194

  Fly   167 GRLAI-GDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHS 230
            ||||: |....|:||||.||:||:.|..:||.|.||||:|||.|||.|||.||:..:|||::.||
plant   195 GRLAMRGREPLFVPCTPKGCIELLHRYNIEIKGKRAVVIGRSNIVGMPAALLLQREDATVSIIHS 259

  Fly   231 KTRNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLVGDVDYAEAL 295
            :|:|.|||||.|||::..:|...||:|||||||||:||.|||...|.|.|.|.:||||:.|.||.
plant   260 RTKNPEEITREADIIISAVGQPNMVRGSWIKPGAVLIDVGINPVEDPSAARGYRLVGDICYEEAS 324

  Fly   296 QVAGHLTPVPGGVGPMTVAMLMKNTVRSAAR 326
            :||..:|||||||||||:|||:.||:.||.|
plant   325 KVASAITPVPGGVGPMTIAMLLSNTLTSAKR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 154/289 (53%)
THF_DHG_CYH 40..159 CDD:279147 52/118 (44%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 102/170 (60%)
FTHFS 350..968 CDD:279592
EMB3127NP_191971.1 PLN02616 1..360 CDD:215332 156/291 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - O PTHR48099
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.